KEGG   Tsukamurella paurometabola: Tpau_1893Help
Entry
Tpau_1893         CDS       T01228                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tpr  Tsukamurella paurometabola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tpr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1979166..1980431
Genome map
AA seq 421 aa AA seqDB search
MSNIAVVGAGISGLVAALRLEQAGARVTVFESGNRVGGKLRSETIGGTRLDVGAEAFVQR
RPEVLDLAAELGLADEVVAPAGRRPALFSDGALRGHFGRTLMGVPVDADEVRLPMSWKRG
GDSSIGDLVRSRFGDEVVERSVDPMVSGVFAAHADDVSVRAALPALADRLDQGTDSLSTA
VRDALGEPTDTPVFGTFRGGYQQLLDALAERLGDRIMLGAPVPEVRPQWSLRGSMFDAVV
LAVPAPQVGRLVSGYYPELAAAVGKIPAASSALVTLRLPDDTPLPDLSGVLVASREQVSA
KAITLSGRKWDHLPDGAVRLSFGRLGVSRIVDDLDAGLIAAAREDLATVLGVTADPTAVH
VQRWYEGIPVYLPGHRDTLAAIDAATPAGLVLAGAYFDGVGVPACIARAEAAAASVIEQL
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcgccgtcgtcggagcgggcatctccgggctcgtcgccgccctccggctg
gaacaggccggggcccgggtcaccgtcttcgaatccgggaatcgggtcggtggcaagctc
cgatcggagaccatcggaggaacccggctcgatgtgggcgccgaggccttcgtgcagcgc
cggcccgaggtcctggacctggccgccgaactcggactggccgacgaggtggtcgctccg
gcgggccgtcgtccggccctgttctccgacggtgcgttgcgtggtcacttcggccgcacc
ctgatgggcgtccccgtcgatgccgacgaggtacgactgccgatgagctggaagcgcggc
ggcgattcgtcgatcggcgacctggtgcggtcccggttcggcgatgaggtcgtcgagcgc
agcgtcgacccgatggtgtccggtgtgttcgccgcgcatgcggacgacgtatcggtgcgt
gccgcgctgcccgcgctggcggaccgcctcgatcagggcaccgactcgttgagcaccgcg
gtccgcgacgccctcggtgaacccaccgataccccggtcttcggtaccttccgcggcggc
taccagcagttgctcgacgccctcgcggagcgtctcggcgaccggatcatgctcggcgcc
ccggtaccggaagtacggccgcagtggagcctgcgcggttccatgttcgacgccgtggtg
ctcgcagtgcctgcgccgcaggtgggacgactggtatcgggctactacccggaactcgcc
gccgcggtcggcaagatccccgccgcgagttcggctctggtcaccctgcggctgcccgat
gacaccccgctgcccgacctgtccggtgtcctggtcgcgagccgggaacaggtgagcgcc
aaggcgatcacgctctccggccgcaagtgggaccacctgcccgacggtgccgtgcggctg
tccttcggccgtctcggcgtgagccgcatcgtcgacgacctcgacgccgggctgatcgcc
gcggcacgcgaggatctggcaaccgtgctcggtgtgaccgcggatccgacggcggtgcac
gtgcagcgctggtacgaggggatcccggtgtatctgccgggccaccgcgacacgttggcc
gcgatcgatgccgccaccccggcgggcctggtgctggccggcgcctacttcgacggtgtc
ggggttcccgcctgcatcgctcgcgcggaggcggccgcggcgagcgtcatcgagcaactg
tcctag

DBGET integrated database retrieval system