KEGG   Tsukamurella paurometabola: Tpau_2046Help
Entry
Tpau_2046         CDS       T01228                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tpr  Tsukamurella paurometabola
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpau_2046
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tpau_2046
Enzymes [BR:tpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Tpau_2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2131071..2131889
Genome map
AA seq 272 aa AA seqDB search
MTSPTALDAIIEGVRADLAAREAVLDLAAVKAAAKAAPPAIDATAALREPGIAVIAEVKR
ASPSKGDLAGIADPAQLAAEYEAGGARAISVLTEERRFKGSLADLDSVRAAVQIPVLRKD
FIVSPYQIHEARAHGADIVLLIVAALEQSVLVSLLDRIESLGMTALVEVHTEDEADRALE
AGATVIGVNARNLKTLEVDRDSFARIAPGLPSSVIKIAESGVRDSRDLLTYAGAGADGVL
VGEGLVTAGDPRSAVADLVTAGSHPSCPRPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcacccactgcgctcgatgcgatcatcgagggtgtgcgcgcggacctcgccgcc
cgtgaggcggtgctggacctggccgccgtcaaggccgctgcgaaggccgcgccgcccgcc
atcgacgccaccgccgcactccgtgagcccggcatcgccgtgatcgccgaagtgaagcgg
gcgagtccgtcgaaaggggatctggcaggcatcgccgaccccgctcagctcgccgccgag
tacgaggccgggggagcgcgtgcgatcagcgtgctcaccgaggagcgccgcttcaagggc
tcgctcgccgatctcgactccgtgcgtgcagcggtgcagatcccggtgctgcgcaaggac
ttcatcgtctcgccctatcagatccacgaggcccgggcgcacggcgccgatatcgtgctg
ctcatcgtcgctgcgctggagcagtcggtgctcgtctccctgctggaccgcatcgaatcg
ctggggatgaccgcgctcgtcgaggtgcataccgaagacgaggccgaccgcgccctggag
gccggtgcaacagtgatcggagtgaacgcacgcaacctcaagacgcttgaggtggaccgg
gattcgttcgcccggatcgccccgggcctgccgtcgtcggtgatcaagatcgccgaatcg
ggagtacgcgacagccgggatcttctgacttacgccggcgccggtgccgacggtgtcctg
gtcggcgagggactcgttaccgccggtgacccgaggtcggcggtggccgatctggtcacc
gccggatcgcaccccagctgcccgcgccccgcgcgctga

DBGET integrated database retrieval system