KEGG   Tsukamurella paurometabola: Tpau_2046Help
Entry
Tpau_2046         CDS       T01228                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01130  Biosynthesis of antibiotics
tpr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tpau_2046
Enzymes [BR:tpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Tpau_2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase
Motif
Other DBs
NCBI-ProteinID: ADG78658
UniProt: D5UNU0
Position
2131071..2131889
Genome map
AA seq 272 aa AA seqDB search
MTSPTALDAIIEGVRADLAAREAVLDLAAVKAAAKAAPPAIDATAALREPGIAVIAEVKR
ASPSKGDLAGIADPAQLAAEYEAGGARAISVLTEERRFKGSLADLDSVRAAVQIPVLRKD
FIVSPYQIHEARAHGADIVLLIVAALEQSVLVSLLDRIESLGMTALVEVHTEDEADRALE
AGATVIGVNARNLKTLEVDRDSFARIAPGLPSSVIKIAESGVRDSRDLLTYAGAGADGVL
VGEGLVTAGDPRSAVADLVTAGSHPSCPRPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcacccactgcgctcgatgcgatcatcgagggtgtgcgcgcggacctcgccgcc
cgtgaggcggtgctggacctggccgccgtcaaggccgctgcgaaggccgcgccgcccgcc
atcgacgccaccgccgcactccgtgagcccggcatcgccgtgatcgccgaagtgaagcgg
gcgagtccgtcgaaaggggatctggcaggcatcgccgaccccgctcagctcgccgccgag
tacgaggccgggggagcgcgtgcgatcagcgtgctcaccgaggagcgccgcttcaagggc
tcgctcgccgatctcgactccgtgcgtgcagcggtgcagatcccggtgctgcgcaaggac
ttcatcgtctcgccctatcagatccacgaggcccgggcgcacggcgccgatatcgtgctg
ctcatcgtcgctgcgctggagcagtcggtgctcgtctccctgctggaccgcatcgaatcg
ctggggatgaccgcgctcgtcgaggtgcataccgaagacgaggccgaccgcgccctggag
gccggtgcaacagtgatcggagtgaacgcacgcaacctcaagacgcttgaggtggaccgg
gattcgttcgcccggatcgccccgggcctgccgtcgtcggtgatcaagatcgccgaatcg
ggagtacgcgacagccgggatcttctgacttacgccggcgccggtgccgacggtgtcctg
gtcggcgagggactcgttaccgccggtgacccgaggtcggcggtggccgatctggtcacc
gccggatcgcaccccagctgcccgcgccccgcgcgctga

DBGET integrated database retrieval system