KEGG   Tsukamurella paurometabola: Tpau_2054Help
Entry
Tpau_2054         CDS       T01228                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpau_2054
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpau_2054
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tpau_2054
Enzymes [BR:tpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tpau_2054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2138555..2139886
Genome map
AA seq 443 aa AA seqDB search
MRDTGLVSLPEASTGLSQRSAYEPDGTGHWGVWGGRHVPEALMAVIEEVTAEFEKVRSDR
EFLAELDRLQRQYTGRPSPLYPCTRLGEHAGGASILLKREDLNHTGSHKINNVLGQVLLA
KRMGKTRVIAETGAGQHGVATATACALLGIECVIFMGKVDTDRQALNVARMRLLGAEVIA
VASGSATLKDAINEALRDWVSHADDTYYCFGTAAGPHPFPLLVRDLQRIVGMEAREQVLD
LAGRLPDAVVACVGGGSNAIGIFHPFIPDEGVRLVGCEAAGDGVETGRHAATFTGGTPGA
FQGAYSYLLQDDDGQTIESHSISAGLDYPGVGPEHAELKESGRAEYVPITDAEAMDAFEL
LCRTEGIIPAIESAHAVAGALKLGAELGPGAVIVVNLSGRGDKDVDTAGRWFGLLDDEGN
VVGQKVIGEDLNTEFRDAEEAAK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgagggatactgggctggtgagtctcccagaagccagcaccggactgtcccagcgatcg
gcgtacgagccggatgggaccgggcactggggagtctggggcggtagacacgtacctgaa
gcgctgatggctgtgatcgaggaggtcacggccgaattcgagaaggtccgcagcgatcgc
gagttcctggcggagctcgaccggctccagcggcagtacaccggtcgcccgtctcccttg
tacccgtgcacccggctcggcgagcatgccggcggtgcgtcgatcctcctcaagcgcgag
gacctcaaccacaccggcagtcacaagataaacaacgtgctcggacaagtgctgctcgcc
aagcggatgggcaagacgcgggtgatcgcggagaccggcgccggtcagcacggcgtggca
acggcgacggcatgcgcgctgctcggcatcgagtgcgtgatcttcatgggaaaggtcgat
accgaccggcaggcgctcaacgtagccaggatgcggttgctcggcgccgaggtgatcgcg
gtggcgtccggatcggcgactctcaaagacgcgatcaacgaggcgcttcgggattgggtc
agtcacgccgacgacacctactactgtttcggcaccgccgccgggccgcatccgttcccg
ctgctggtgcgagacctgcagcgcattgtcggaatggaggcacgggagcaggtgctcgac
ctcgccgggcggctcccggacgccgtagtcgcctgtgtcggcggcgggtccaatgccatc
ggcatcttccaccccttcattccggacgagggcgtacgcctggtcgggtgtgaagccgcc
ggcgacggagtcgaaaccggcaggcacgcggccaccttcaccggcgggacgcccggtgcc
ttccagggggcgtactcgtatctgttgcaggacgacgacggacagacgatcgaatcgcac
tcgatctccgccgggctcgattatccgggcgtcggcccggagcacgccgagctcaaggag
tccggtcgcgccgaatacgtcccgatcaccgacgccgaggcgatggacgccttcgagttg
ttgtgccggaccgaggggatcatcccggcgatcgagtccgcgcacgcggtggccggcgcg
ctcaaactgggggccgaactcggcccgggggcggtgatcgtggtgaacctctccggtcgc
ggagacaaggacgtcgacaccgccgggcggtggttcgggctgctcgacgacgaagggaac
gtagtggggcagaaggtgatcggtgaggatctcaacaccgaattccgcgacgccgaggag
gccgcgaaatga

DBGET integrated database retrieval system