KEGG   Tsukamurella paurometabola: Tpau_2054Help
Entry
Tpau_2054         CDS       T01228                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpau_2054
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpau_2054
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tpau_2054
Enzymes [BR:tpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tpau_2054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2138555..2139886
Genome map
AA seq 443 aa AA seqDB search
MRDTGLVSLPEASTGLSQRSAYEPDGTGHWGVWGGRHVPEALMAVIEEVTAEFEKVRSDR
EFLAELDRLQRQYTGRPSPLYPCTRLGEHAGGASILLKREDLNHTGSHKINNVLGQVLLA
KRMGKTRVIAETGAGQHGVATATACALLGIECVIFMGKVDTDRQALNVARMRLLGAEVIA
VASGSATLKDAINEALRDWVSHADDTYYCFGTAAGPHPFPLLVRDLQRIVGMEAREQVLD
LAGRLPDAVVACVGGGSNAIGIFHPFIPDEGVRLVGCEAAGDGVETGRHAATFTGGTPGA
FQGAYSYLLQDDDGQTIESHSISAGLDYPGVGPEHAELKESGRAEYVPITDAEAMDAFEL
LCRTEGIIPAIESAHAVAGALKLGAELGPGAVIVVNLSGRGDKDVDTAGRWFGLLDDEGN
VVGQKVIGEDLNTEFRDAEEAAK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgagggatactgggctggtgagtctcccagaagccagcaccggactgtcccagcgatcg
gcgtacgagccggatgggaccgggcactggggagtctggggcggtagacacgtacctgaa
gcgctgatggctgtgatcgaggaggtcacggccgaattcgagaaggtccgcagcgatcgc
gagttcctggcggagctcgaccggctccagcggcagtacaccggtcgcccgtctcccttg
tacccgtgcacccggctcggcgagcatgccggcggtgcgtcgatcctcctcaagcgcgag
gacctcaaccacaccggcagtcacaagataaacaacgtgctcggacaagtgctgctcgcc
aagcggatgggcaagacgcgggtgatcgcggagaccggcgccggtcagcacggcgtggca
acggcgacggcatgcgcgctgctcggcatcgagtgcgtgatcttcatgggaaaggtcgat
accgaccggcaggcgctcaacgtagccaggatgcggttgctcggcgccgaggtgatcgcg
gtggcgtccggatcggcgactctcaaagacgcgatcaacgaggcgcttcgggattgggtc
agtcacgccgacgacacctactactgtttcggcaccgccgccgggccgcatccgttcccg
ctgctggtgcgagacctgcagcgcattgtcggaatggaggcacgggagcaggtgctcgac
ctcgccgggcggctcccggacgccgtagtcgcctgtgtcggcggcgggtccaatgccatc
ggcatcttccaccccttcattccggacgagggcgtacgcctggtcgggtgtgaagccgcc
ggcgacggagtcgaaaccggcaggcacgcggccaccttcaccggcgggacgcccggtgcc
ttccagggggcgtactcgtatctgttgcaggacgacgacggacagacgatcgaatcgcac
tcgatctccgccgggctcgattatccgggcgtcggcccggagcacgccgagctcaaggag
tccggtcgcgccgaatacgtcccgatcaccgacgccgaggcgatggacgccttcgagttg
ttgtgccggaccgaggggatcatcccggcgatcgagtccgcgcacgcggtggccggcgcg
ctcaaactgggggccgaactcggcccgggggcggtgatcgtggtgaacctctccggtcgc
ggagacaaggacgtcgacaccgccgggcggtggttcgggctgctcgacgacgaagggaac
gtagtggggcagaaggtgatcggtgaggatctcaacaccgaattccgcgacgccgaggag
gccgcgaaatga

DBGET integrated database retrieval system