KEGG   Tsukamurella paurometabola: Tpau_2055Help
Entry
Tpau_2055         CDS       T01228                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpau_2055
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpau_2055
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tpau_2055
Enzymes [BR:tpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tpau_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2139883..2140665
Genome map
AA seq 260 aa AA seqDB search
MSALASVFETCHAENRAALVTYLPCGYPSKDGGRAIVAGMVGSGADIVEIGVAYSDPVMD
GPVIQRAADDALRGGVRVHDVFGYAEAVAAAGGAPVVMSYWNPILKYGVEAFARDLAAAG
GQGIITPNLIPEEAQDWIAAADRYGLDKIFLVAPSSTTERLSMTAEASSGFLYVASTMGV
TGARDTVDNVAPELVARVREVSDIPVGVGLGVRSREQAAEIAAYADAVIAGSALVSAAAE
SIDAVKRLTAELAAGVRDRS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgctcgcctccgtcttcgagacctgccacgccgagaatcgcgccgcgctggtg
acctatctgccgtgcgggtatccctccaaggacgggggccgagcgatcgtggccggaatg
gtcggatcgggcgccgacatcgtcgagatcggcgtggcgtacagcgatcccgtcatggac
ggacccgtgatccagcgcgccgccgatgacgcgttgcgcggcggcgtacgggtgcacgac
gtcttcggctacgcggaggcggtcgctgcggcgggtggcgcgccggtcgtgatgagctat
tggaacccgatcctcaagtacggggtggaggccttcgcccgcgacctcgcggccgcgggt
ggtcaggggatcatcacgcccaacctgatccctgaggaggcacaggactggatcgccgcc
gccgaccggtacggcttggacaagatcttcctggtcgccccgtcgtcgacgaccgagcgg
ctcagcatgacggcggaggcgtcctcgggcttcctctacgtcgcctcgacgatgggcgtc
accggggcgcgcgacaccgtcgacaacgtcgctccggagctggttgcgcgggtgcgcgaa
gtctccgacatcccggtcggtgtgggcttgggagttcgatcgcgcgagcaggcggccgag
atcgccgcctacgcggacgccgtgatcgctggatcagctctggtgagtgcggcggctgag
tcgatcgacgcggtgaaacgattgaccgcggagctggcggccggagtccgcgaccggagc
tga

DBGET integrated database retrieval system