KEGG   Tsukamurella paurometabola: Tpau_2055Help
Entry
Tpau_2055         CDS       T01228                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tpr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:tpr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2139883..2140665
Genome map
AA seq 260 aa AA seqDB search
MSALASVFETCHAENRAALVTYLPCGYPSKDGGRAIVAGMVGSGADIVEIGVAYSDPVMD
GPVIQRAADDALRGGVRVHDVFGYAEAVAAAGGAPVVMSYWNPILKYGVEAFARDLAAAG
GQGIITPNLIPEEAQDWIAAADRYGLDKIFLVAPSSTTERLSMTAEASSGFLYVASTMGV
TGARDTVDNVAPELVARVREVSDIPVGVGLGVRSREQAAEIAAYADAVIAGSALVSAAAE
SIDAVKRLTAELAAGVRDRS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgctcgcctccgtcttcgagacctgccacgccgagaatcgcgccgcgctggtg
acctatctgccgtgcgggtatccctccaaggacgggggccgagcgatcgtggccggaatg
gtcggatcgggcgccgacatcgtcgagatcggcgtggcgtacagcgatcccgtcatggac
ggacccgtgatccagcgcgccgccgatgacgcgttgcgcggcggcgtacgggtgcacgac
gtcttcggctacgcggaggcggtcgctgcggcgggtggcgcgccggtcgtgatgagctat
tggaacccgatcctcaagtacggggtggaggccttcgcccgcgacctcgcggccgcgggt
ggtcaggggatcatcacgcccaacctgatccctgaggaggcacaggactggatcgccgcc
gccgaccggtacggcttggacaagatcttcctggtcgccccgtcgtcgacgaccgagcgg
ctcagcatgacggcggaggcgtcctcgggcttcctctacgtcgcctcgacgatgggcgtc
accggggcgcgcgacaccgtcgacaacgtcgctccggagctggttgcgcgggtgcgcgaa
gtctccgacatcccggtcggtgtgggcttgggagttcgatcgcgcgagcaggcggccgag
atcgccgcctacgcggacgccgtgatcgctggatcagctctggtgagtgcggcggctgag
tcgatcgacgcggtgaaacgattgaccgcggagctggcggccggagtccgcgaccggagc
tga

DBGET integrated database retrieval system