KEGG   Tsukamurella paurometabola: Tpau_2149Help
Entry
Tpau_2149         CDS       T01228                                 

Definition
phosphoribosyl-ATP diphosphatase
Orthology
K01523  
phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
tpr  Tsukamurella paurometabola
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tpr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2244211..2244492
Genome map
AA seq 93 aa AA seqDB search
MGQSITVKTMETLFAELAEKARTRPAGSGTVEALDNGIHFLGKKVLEEAGEVWIAAEHQG
DAELAEEASQLLYWLQVLLIKRGLTLDDVYSYL
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
gtgggacaatcgatcaccgtgaagaccatggagacgctgttcgctgagttggccgagaag
gcccggacgcggcccgccgggagcgggaccgtcgaagcactggacaacggcatccatttc
ctgggcaagaaggtgctggaggaggccggcgaggtgtggatcgcggcggagcatcagggc
gatgccgagctcgccgaggaggcctcgcaactgctgtactggctgcaggtgttgctgatc
aaacggggcctgacgctcgacgacgtgtactcgtacctctga

DBGET integrated database retrieval system