KEGG   Tsukamurella paurometabola: Tpau_2149Help
Entry
Tpau_2149         CDS       T01228                                 

Definition
phosphoribosyl-ATP diphosphatase
Orthology
K01523  
phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
tpr  Tsukamurella paurometabola
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpau_2149
  Amino acid metabolism
   00340 Histidine metabolism
    Tpau_2149
Enzymes [BR:tpr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Tpau_2149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2244211..2244492
Genome map
AA seq 93 aa AA seqDB search
MGQSITVKTMETLFAELAEKARTRPAGSGTVEALDNGIHFLGKKVLEEAGEVWIAAEHQG
DAELAEEASQLLYWLQVLLIKRGLTLDDVYSYL
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
gtgggacaatcgatcaccgtgaagaccatggagacgctgttcgctgagttggccgagaag
gcccggacgcggcccgccgggagcgggaccgtcgaagcactggacaacggcatccatttc
ctgggcaagaaggtgctggaggaggccggcgaggtgtggatcgcggcggagcatcagggc
gatgccgagctcgccgaggaggcctcgcaactgctgtactggctgcaggtgttgctgatc
aaacggggcctgacgctcgacgacgtgtactcgtacctctga

DBGET integrated database retrieval system