KEGG   Tsukamurella paurometabola: Tpau_2149Help
Entry
Tpau_2149         CDS       T01228                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00340  Histidine metabolism
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01230  Biosynthesis of amino acids
Module
tpr_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Tpau_2149
Enzymes [BR:tpr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Tpau_2149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ADG78760
UniProt: D5UPK4
Position
2244211..2244492
Genome map
AA seq 93 aa AA seqDB search
MGQSITVKTMETLFAELAEKARTRPAGSGTVEALDNGIHFLGKKVLEEAGEVWIAAEHQG
DAELAEEASQLLYWLQVLLIKRGLTLDDVYSYL
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
gtgggacaatcgatcaccgtgaagaccatggagacgctgttcgctgagttggccgagaag
gcccggacgcggcccgccgggagcgggaccgtcgaagcactggacaacggcatccatttc
ctgggcaagaaggtgctggaggaggccggcgaggtgtggatcgcggcggagcatcagggc
gatgccgagctcgccgaggaggcctcgcaactgctgtactggctgcaggtgttgctgatc
aaacggggcctgacgctcgacgacgtgtactcgtacctctga

DBGET integrated database retrieval system