KEGG   Tsukamurella paurometabola: Tpau_2253Help
Entry
Tpau_2253         CDS       T01228                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tpr  Tsukamurella paurometabola
Brite
Enzymes [BR:tpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Tpau_2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2342340..2343485
Genome map
AA seq 381 aa AA seqDB search
MFRRAALLSTVALLAAGCAAAPPSTPDPPPDETVCGTDAASLRTLAQRSGIDVGTAYRSS
FAPGDTCYEAVARAAFSSLTTEIGTMTNTVAPEAGRFDFREADAVAETARRSGQRFQIHS
LIWDPLDQQAWGIVPAYAQRMSDPARHDFLLELVTAVVRRYAGSADTVTVVNEPFDQRGN
LQRNAWWRTTGDDRYIVDAFRAARLAAPKMKLYLNEHSAETVSDKSTALLTLARKLKAMS
VDVESDGTRVRKPLIDGVGFQAHMLGGADQQPSVADMRTNLRRFIDAGLEVRLTELDVRI
PTEDGQSTTADQRRQGEVYRTMVSLCRELRRCTGATVWGFTDKRSWITDYPATFSGYGNA
NLLDAHYRPKPAWDGIRAALS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtcgtgccgcactcctgtcgacggtcgcacttctcgctgccggctgcgcggcg
gcgcccccatcaacgccggacccgcctcccgacgaaaccgtgtgcggcaccgacgcggcc
tcgctccgaacactggcgcagcggtccggaatcgacgtcgggaccgcctacagatcctcg
ttcgcgcccggcgacacctgctacgaagccgtggcgcgcgccgccttcagctcgttgacc
acagagatcgggacgatgacgaacaccgtcgcccccgaggcaggccgtttcgacttccgc
gaggcggatgcggtcgccgagaccgcccgccgcagcgggcaacgcttccagatccattca
ctgatctgggatccgctcgaccaacaggcgtggggaatcgtgcctgcgtacgcgcagcgg
atgagcgatccggcgcgccacgacttcctgctcgaactggtcaccgcggtggtccggcga
tacgccgggtcggccgacaccgtgaccgtggtgaacgagcccttcgaccagcgcggcaac
ctgcagcgcaacgcctggtggcggaccacgggcgatgaccggtacatcgtggacgccttc
cgcgccgcccggctggccgcaccgaagatgaagctgtacctcaacgagcacagtgcggag
accgtcagcgacaagtcgactgcgctgctgaccttggcccggaaactcaaggccatgagc
gtcgacgtggagagcgacggcacccgcgtccgcaagccactgatcgacggtgtcggattc
caggcacacatgctcggcggagccgatcagcaaccatccgtcgccgatatgcgaaccaat
ctccgcaggttcatcgacgccggactggaggtgcggctgaccgaactcgacgtgcggatc
cccaccgaagacggacagtccaccacggcggaccagcgacgccagggcgaggtgtaccgc
accatggtgtcgctgtgtcgagaactgcgccgctgcaccggcgctacggtctggggcttc
acggacaagcgctcctggatcaccgactatcccgcaaccttctccggatacggcaacgcg
aatctgctcgacgcgcactaccgcccgaaacccgcctgggacggcattcgcgccgctctg
agctga

DBGET integrated database retrieval system