KEGG   Tsukamurella paurometabola: Tpau_2328Help
Entry
Tpau_2328         CDS       T01228                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tpr  Tsukamurella paurometabola
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpau_2328
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tpau_2328
   00630 Glyoxylate and dicarboxylate metabolism
    Tpau_2328
Enzymes [BR:tpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Tpau_2328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2421677..2423863
Genome map
AA seq 728 aa AA seqDB search
MADTARTSVAGLDVATVLYDFINNEALPGTGVDQAAFWTGAAKLIGDLVPKNKALLAKRD
ELQAKIDDFHAAAPGPVDFPAYKQFLTDIGYLVPATEDREITTDKVDTEITSTAGPQLVV
PILNARFAINASNARWGSLYDALYGTDAISEADGAEKGTSYNKVRGDKVIAFAKDFLDQA
VPLESGSHADVTEYRINGTELLATVAGASGASEDASVGLADPSAFVGYTGERAAPTGILL
RHNGLHLEIQIDPASPIGSTDRAGVKDVLVESAVTTIMDFEDSVAAVDADDKVVGYRNWL
GLNKGDLAEEVTKGGKTFTRTLNPDRVYTATDGSELVLHGRSLLFVRNVGHLMTTDAILL
DGEEIGEGILDGIVTSLIAIHGLSGEVKNSRTGSIYIVKPKMHGPEEVAFAAEIFERVEQ
ILGLPALTLKMGIMDEERRTSVNLKAAIAAANDRVVFINTGFLDRTGDEIHTSMVAGPIV
RKGELKAQTWYPAYEDSNVDIGLHAGLQHKAQIGKGMWAMPDLMAAMLEQKIAQPKAGAT
TAWVPSPTAATLHALHYHLVDVFETQNEIAKRDPASVDDILTIPLAPKTDWSDAEKREEL
DNNSQSILGYVVRWIDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGIVTEDEI
VESLKRMAPVVDQQNAGDPEYRPLAPDFDSNIAFQAAKDLILLGGEQPSGYTEPILHARR
REFKAANS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggccgataccgcccgcacgtccgtcgccggtctcgatgtcgcgacggttctctacgac
ttcatcaacaacgaggcccttccgggcacgggcgtagaccaggccgccttctggaccggt
gcggcgaagctgatcggcgacctcgttccgaagaacaaggcactgctcgccaagcgcgac
gagttgcaggcgaagatcgacgacttccacgcggcggccccgggacccgtggacttcccc
gcctacaagcagttcctcaccgacatcggctacctcgtgcccgccaccgaggaccgtgag
atcaccaccgacaaggtcgacaccgagatcacctcgaccgcgggcccacagctggtcgtg
ccgatcctcaacgcccgcttcgcgatcaacgcctcgaatgcgcgctggggctcgctctac
gacgcgctctacggcaccgatgccatctccgaggccgacggcgcggagaagggcacgagc
tacaacaaggtccgcggtgacaaggtgatcgccttcgccaaggacttcctggatcaggcc
gtgccgctcgagtcgggctcgcacgcggatgtcaccgagtaccgcatcaacggcaccgag
ctgctcgcgaccgtcgccggggcgtcgggcgccagcgaggacgcttcggtcggcctcgcc
gacccgtcggccttcgtcggctacaccggtgagcgcgccgcgccgaccggcatcctgctg
cgtcacaacggcctgcacctggagatccagatcgatccggcgtccccgatcggctccacc
gatcgcgcgggcgtcaaggacgtgctcgtcgagtccgcggtcaccacgatcatggacttc
gaggactcggtcgcggccgtcgacgccgacgacaaggtcgtgggctaccggaactggctg
ggcctgaacaagggcgacctggccgaagaggtcaccaagggcggcaagaccttcacccgc
acgctgaacccggaccgggtctacaccgcgaccgacggctcggagctggttctgcacggc
cgctcgctgctgttcgtgcgcaatgtgggccacctgatgaccacggacgcgatcctgctg
gacggcgaagagatcggcgagggcatcctcgacggcatcgtcacctcgctgatcgcgatc
cacggactgtcgggcgaggtcaagaactcgcgcaccggctcgatctacatcgtcaagccc
aagatgcacggccccgaggaggtggcgttcgccgccgagatcttcgaacgcgtcgagcag
atcctgggcctgcccgccctcaccctgaagatgggcatcatggatgaggagcgccgcacc
tcggtgaacctcaaggccgcgatcgccgccgcgaacgatcgcgtggtgttcatcaacacc
ggcttcctcgatcgcaccggcgacgagatccacacctcgatggtcgccggaccgatcgtc
cgcaagggcgagctcaaggcacagacctggtaccccgcctacgaggactccaacgtcgac
atcggcctgcacgccggactgcagcacaaggcgcagatcggtaagggcatgtgggccatg
cccgacctgatggccgcgatgctggagcagaagatcgcccagcccaaggccggcgctacg
accgcatgggttccttcgcccacggccgcgacgctgcacgcgctgcactaccacctggtg
gacgtgttcgagacccagaacgagatcgccaagcgggatccggcttcggtcgacgacatc
ctcaccatccccttggctccgaagaccgattggtccgacgccgagaagcgcgaggagctc
gacaacaacagccagtcgatcctcggttacgtggtgcggtggatcgaccagggcgtgggt
tgctcgaaggtgcccgacatccacgacgtcgcgctcatggaggatcgcgccacgctgcgc
atcagctcgcagctgctggcgaactggctgcggcacggcatcgtgaccgaggatgagatc
gtggagtcgctcaagcggatggcgccggtggtcgaccagcagaacgcgggcgaccccgag
taccggccgctggcacccgatttcgactcgaacatcgccttccaggccgcgaaggacctg
atcctgctgggcggcgagcagccgagcggctacaccgagccgatcctgcatgcgcgtcgg
cgcgagttcaaggccgcgaacagctga

DBGET integrated database retrieval system