KEGG   Tsukamurella paurometabola: Tpau_2328Help
Entry
Tpau_2328         CDS       T01228                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00620  Pyruvate metabolism
tpr00630  Glyoxylate and dicarboxylate metabolism
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tpau_2328
   00630 Glyoxylate and dicarboxylate metabolism
    Tpau_2328
Enzymes [BR:tpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Tpau_2328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADG78935
UniProt: D5UQG5
Position
2421677..2423863
Genome map
AA seq 728 aa AA seqDB search
MADTARTSVAGLDVATVLYDFINNEALPGTGVDQAAFWTGAAKLIGDLVPKNKALLAKRD
ELQAKIDDFHAAAPGPVDFPAYKQFLTDIGYLVPATEDREITTDKVDTEITSTAGPQLVV
PILNARFAINASNARWGSLYDALYGTDAISEADGAEKGTSYNKVRGDKVIAFAKDFLDQA
VPLESGSHADVTEYRINGTELLATVAGASGASEDASVGLADPSAFVGYTGERAAPTGILL
RHNGLHLEIQIDPASPIGSTDRAGVKDVLVESAVTTIMDFEDSVAAVDADDKVVGYRNWL
GLNKGDLAEEVTKGGKTFTRTLNPDRVYTATDGSELVLHGRSLLFVRNVGHLMTTDAILL
DGEEIGEGILDGIVTSLIAIHGLSGEVKNSRTGSIYIVKPKMHGPEEVAFAAEIFERVEQ
ILGLPALTLKMGIMDEERRTSVNLKAAIAAANDRVVFINTGFLDRTGDEIHTSMVAGPIV
RKGELKAQTWYPAYEDSNVDIGLHAGLQHKAQIGKGMWAMPDLMAAMLEQKIAQPKAGAT
TAWVPSPTAATLHALHYHLVDVFETQNEIAKRDPASVDDILTIPLAPKTDWSDAEKREEL
DNNSQSILGYVVRWIDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGIVTEDEI
VESLKRMAPVVDQQNAGDPEYRPLAPDFDSNIAFQAAKDLILLGGEQPSGYTEPILHARR
REFKAANS
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggccgataccgcccgcacgtccgtcgccggtctcgatgtcgcgacggttctctacgac
ttcatcaacaacgaggcccttccgggcacgggcgtagaccaggccgccttctggaccggt
gcggcgaagctgatcggcgacctcgttccgaagaacaaggcactgctcgccaagcgcgac
gagttgcaggcgaagatcgacgacttccacgcggcggccccgggacccgtggacttcccc
gcctacaagcagttcctcaccgacatcggctacctcgtgcccgccaccgaggaccgtgag
atcaccaccgacaaggtcgacaccgagatcacctcgaccgcgggcccacagctggtcgtg
ccgatcctcaacgcccgcttcgcgatcaacgcctcgaatgcgcgctggggctcgctctac
gacgcgctctacggcaccgatgccatctccgaggccgacggcgcggagaagggcacgagc
tacaacaaggtccgcggtgacaaggtgatcgccttcgccaaggacttcctggatcaggcc
gtgccgctcgagtcgggctcgcacgcggatgtcaccgagtaccgcatcaacggcaccgag
ctgctcgcgaccgtcgccggggcgtcgggcgccagcgaggacgcttcggtcggcctcgcc
gacccgtcggccttcgtcggctacaccggtgagcgcgccgcgccgaccggcatcctgctg
cgtcacaacggcctgcacctggagatccagatcgatccggcgtccccgatcggctccacc
gatcgcgcgggcgtcaaggacgtgctcgtcgagtccgcggtcaccacgatcatggacttc
gaggactcggtcgcggccgtcgacgccgacgacaaggtcgtgggctaccggaactggctg
ggcctgaacaagggcgacctggccgaagaggtcaccaagggcggcaagaccttcacccgc
acgctgaacccggaccgggtctacaccgcgaccgacggctcggagctggttctgcacggc
cgctcgctgctgttcgtgcgcaatgtgggccacctgatgaccacggacgcgatcctgctg
gacggcgaagagatcggcgagggcatcctcgacggcatcgtcacctcgctgatcgcgatc
cacggactgtcgggcgaggtcaagaactcgcgcaccggctcgatctacatcgtcaagccc
aagatgcacggccccgaggaggtggcgttcgccgccgagatcttcgaacgcgtcgagcag
atcctgggcctgcccgccctcaccctgaagatgggcatcatggatgaggagcgccgcacc
tcggtgaacctcaaggccgcgatcgccgccgcgaacgatcgcgtggtgttcatcaacacc
ggcttcctcgatcgcaccggcgacgagatccacacctcgatggtcgccggaccgatcgtc
cgcaagggcgagctcaaggcacagacctggtaccccgcctacgaggactccaacgtcgac
atcggcctgcacgccggactgcagcacaaggcgcagatcggtaagggcatgtgggccatg
cccgacctgatggccgcgatgctggagcagaagatcgcccagcccaaggccggcgctacg
accgcatgggttccttcgcccacggccgcgacgctgcacgcgctgcactaccacctggtg
gacgtgttcgagacccagaacgagatcgccaagcgggatccggcttcggtcgacgacatc
ctcaccatccccttggctccgaagaccgattggtccgacgccgagaagcgcgaggagctc
gacaacaacagccagtcgatcctcggttacgtggtgcggtggatcgaccagggcgtgggt
tgctcgaaggtgcccgacatccacgacgtcgcgctcatggaggatcgcgccacgctgcgc
atcagctcgcagctgctggcgaactggctgcggcacggcatcgtgaccgaggatgagatc
gtggagtcgctcaagcggatggcgccggtggtcgaccagcagaacgcgggcgaccccgag
taccggccgctggcacccgatttcgactcgaacatcgccttccaggccgcgaaggacctg
atcctgctgggcggcgagcagccgagcggctacaccgagccgatcctgcatgcgcgtcgg
cgcgagttcaaggccgcgaacagctga

DBGET integrated database retrieval system