KEGG   Tsukamurella paurometabola: Tpau_2538Help
Entry
Tpau_2538         CDS       T01228                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpau_2538
   01230 Biosynthesis of amino acids
    Tpau_2538
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpau_2538
   00051 Fructose and mannose metabolism
    Tpau_2538
   00562 Inositol phosphate metabolism
    Tpau_2538
Enzymes [BR:tpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tpau_2538
Exosome [BR:tpr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tpau_2538
  Exosomal proteins of bladder cancer cells
   Tpau_2538
  Exosomal proteins of melanoma cells
   Tpau_2538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2631111..2631893)
Genome map
AA seq 260 aa AA seqDB search
MSRKPLIAGNWKMNLNHLEAIAVVQKLAFALPEKYFAKVDVTVIPPFTDLRSVQTAVDGD
GLLITYGAQDLSPHDSGAYTGDISGAFLAKLGCTYVVVGHSERRTIHGETNEIVLEKTKA
ALRHGLTPIVCIGEGLDIREQGTHVEYNIEQLKGSLAGLTADEVSKIVIAYEPVWAIGTG
KVATPADAQEVCAAVRATIAEIASAEVAAGIRVLYGGSVSSKNVGELVAQPDVDGGLVGG
ASLKPDEFAALSAIAAGGPL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcaagccgctgatcgccggcaactggaagatgaacctcaatcacctcgaagcg
atcgcggtggttcagaagctcgctttcgcgttgccggagaagtacttcgccaaagtcgat
gtgacggtgattccgccgttcaccgatcttcgctcggtgcagaccgcggtcgacggagac
ggtctgctcatcacctacggtgcgcaggatctgtctccgcacgactccggcgcgtacacc
ggcgatatctccggggccttcctggcgaagctcggctgcacctatgtggtcgtcggacac
agcgagcgccgcaccatccacggtgagaccaacgagatcgtgctcgagaagacgaaggcc
gcactgcgtcacggcctgactccgatcgtgtgcatcggcgagggcctcgacatccgtgag
cagggcacgcatgtggagtacaacatcgagcagctcaagggttcgctcgccggcctcacc
gccgacgaggtgtcgaagatcgtgatcgcctacgagccggtctgggcaatcgggaccggt
aaggtcgcgacccccgccgacgcccaggaggtgtgcgccgcagtgcgtgccaccatcgcg
gagatcgcgtcggcagaggtggccgcggggatccgcgtcctgtacggcggctccgtgagc
agtaagaacgtcggagagctcgtcgctcagcccgatgtggacggcggcctggtcggcggt
gcctcgctcaagcccgacgagttcgcggcgctcagcgcgatcgccgccggcggaccgctc
tga

DBGET integrated database retrieval system