KEGG   Tsukamurella paurometabola: Tpau_2538Help
Entry
Tpau_2538         CDS       T01228                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00010  Glycolysis / Gluconeogenesis
tpr00051  Fructose and mannose metabolism
tpr00562  Inositol phosphate metabolism
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01130  Biosynthesis of antibiotics
tpr01200  Carbon metabolism
tpr01230  Biosynthesis of amino acids
Module
tpr_M00002  Glycolysis, core module involving three-carbon compounds
tpr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpau_2538
   00051 Fructose and mannose metabolism
    Tpau_2538
   00562 Inositol phosphate metabolism
    Tpau_2538
Enzymes [BR:tpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tpau_2538
Exosome [BR:tpr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tpau_2538
  Exosomal proteins of bladder cancer cells
   Tpau_2538
  Exosomal proteins of melanoma cells
   Tpau_2538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADG79141
UniProt: D5URT6
Position
complement(2631111..2631893)
Genome map
AA seq 260 aa AA seqDB search
MSRKPLIAGNWKMNLNHLEAIAVVQKLAFALPEKYFAKVDVTVIPPFTDLRSVQTAVDGD
GLLITYGAQDLSPHDSGAYTGDISGAFLAKLGCTYVVVGHSERRTIHGETNEIVLEKTKA
ALRHGLTPIVCIGEGLDIREQGTHVEYNIEQLKGSLAGLTADEVSKIVIAYEPVWAIGTG
KVATPADAQEVCAAVRATIAEIASAEVAAGIRVLYGGSVSSKNVGELVAQPDVDGGLVGG
ASLKPDEFAALSAIAAGGPL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcaagccgctgatcgccggcaactggaagatgaacctcaatcacctcgaagcg
atcgcggtggttcagaagctcgctttcgcgttgccggagaagtacttcgccaaagtcgat
gtgacggtgattccgccgttcaccgatcttcgctcggtgcagaccgcggtcgacggagac
ggtctgctcatcacctacggtgcgcaggatctgtctccgcacgactccggcgcgtacacc
ggcgatatctccggggccttcctggcgaagctcggctgcacctatgtggtcgtcggacac
agcgagcgccgcaccatccacggtgagaccaacgagatcgtgctcgagaagacgaaggcc
gcactgcgtcacggcctgactccgatcgtgtgcatcggcgagggcctcgacatccgtgag
cagggcacgcatgtggagtacaacatcgagcagctcaagggttcgctcgccggcctcacc
gccgacgaggtgtcgaagatcgtgatcgcctacgagccggtctgggcaatcgggaccggt
aaggtcgcgacccccgccgacgcccaggaggtgtgcgccgcagtgcgtgccaccatcgcg
gagatcgcgtcggcagaggtggccgcggggatccgcgtcctgtacggcggctccgtgagc
agtaagaacgtcggagagctcgtcgctcagcccgatgtggacggcggcctggtcggcggt
gcctcgctcaagcccgacgagttcgcggcgctcagcgcgatcgccgccggcggaccgctc
tga

DBGET integrated database retrieval system