KEGG   Tsukamurella paurometabola: Tpau_2578Help
Entry
Tpau_2578         CDS       T01228                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tpr  Tsukamurella paurometabola
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tpau_2578
Enzymes [BR:tpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Tpau_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2675650..2676258)
Genome map
AA seq 202 aa AA seqDB search
MTHHVSGVVPAGRRGRLVVLVGPSAVGKSSVVGRLRKEVPDLFFSVSATTRDPRPGEVDG
RDYHFVGDHGFDRLIADGDLLEWAEIHGGLQRSGTPSKPVYQALEAGRPVLVEVDPAGAE
SVKAALPEAVTVFLSPPSWAELERRLRGRGTESPEVIDRRLETARAEMATRDDYDAVVVN
DDLDRAVAELVSLLVGPVARDA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ctgacacatcacgtgtccggagtagttcccgcaggccggaggggccgactggtggtactg
gtcggcccctccgccgttggtaagtcatccgttgtcggccggctccgcaaggaagtgccc
gacctgttcttctcggtgtccgccaccacgcgcgatccgcgccccggtgaggtggacggc
cgcgactaccacttcgtgggcgatcacggcttcgaccggctgatcgccgacggcgacctc
ttggagtgggccgagatccacggtggactgcagcgctcgggcaccccgtccaagccggtc
taccaggctctggaagctggacgcccggtgctggtcgaggtcgaccccgccggcgcggag
agtgtgaaggccgccctccccgaggccgtcaccgtgttcctgagcccgcccagctgggcc
gagctggagcgccgcctgcgtggccgggggaccgagagccccgaggtgatcgaccgccgg
ctcgagactgcgcgggccgaaatggcgacccgtgacgactacgacgcggtcgtcgtgaac
gacgacttggaccgcgccgtggccgagttggtatccttactggtcggccctgtcgcgcgc
gacgcgtag

DBGET integrated database retrieval system