KEGG   Tsukamurella paurometabola: Tpau_2675Help
Entry
Tpau_2675         CDS       T01228                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00010  Glycolysis / Gluconeogenesis
tpr00052  Galactose metabolism
tpr00500  Starch and sucrose metabolism
tpr00520  Amino sugar and nucleotide sugar metabolism
tpr00521  Streptomycin biosynthesis
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01130  Biosynthesis of antibiotics
tpr01200  Carbon metabolism
Module
tpr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpau_2675
   00052 Galactose metabolism
    Tpau_2675
   00500 Starch and sucrose metabolism
    Tpau_2675
   00520 Amino sugar and nucleotide sugar metabolism
    Tpau_2675
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tpau_2675
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tpau_2675
Enzymes [BR:tpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tpau_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N DEDD_Tnp_IS110 TCR Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ADG79275
UniProt: D5USK4
Position
complement(2781635..2782579)
Genome map
AA seq 314 aa AA seqDB search
MTQTIGIDIGGTSVRAGVVTDDGTVVDTARAQTPRSARALEECLDRLVQELCADHDVSAV
GLAVAGFLDPARQKVSFAPHLPWRNAAVPAEMSERIGMPVVMEHDANSAAWAEYVFGPAR
RSTVTCVVALGTGIGCGLLIDGQLYRGAFGVAPELGHLQVVPDGRPCDCGKSGCWERYCS
GTALVETAIDLMGPQGSASVLMARELADDPGSLTGRKVAAAAEAGDPVAQEAVADLARWL
GVGLAMVSDVFDPDLIIVSGGVGASSRLFLDDARDRYASLLTGAKYRRKARIRATELGER
AGMLGAAALARDLG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccatcggcatcgacatcggagggacgtcggtgcgggccggcgtggtgacc
gacgacggcaccgtcgtcgacaccgcccgggcgcagaccccgcgcagtgcccgtgcgctc
gaggaatgcctcgaccgcctggtccaggagctgtgcgccgaccacgacgtctccgcggtg
ggcttggcggtggcgggctttctcgacccggctcggcagaaggtctctttcgctccgcat
ctgccctggcgcaatgccgccgttcccgccgagatgagtgagcgcatcggcatgcccgtg
gtgatggagcacgacgccaactcggcggcctgggccgagtacgtcttcggtcccgcccgc
cgcagcacggtgacctgcgtggtggccctcggcaccggcatcggctgcggcctcttgatc
gacgggcagctctaccgcggcgccttcggcgtggctcccgaactcgggcacctgcaagtg
gttcccgacggaaggccttgtgactgtgggaaatccggatgctgggaacggtattgcagc
ggcactgcgctggtggagaccgcgatcgatctgatgggaccgcagggctcggccagcgtg
ctcatggcgcgtgagctcgcagacgacccgggttcgctcaccgggcgcaaggtggccgcg
gccgcagaagccggcgatcccgtcgcccaggaggccgtcgccgatcttgcacgctggctc
ggcgtgggcctggccatggtcagtgatgtcttcgatcccgatctgatcatcgtgtccggt
ggcgtgggagcatcgtcgcggctgttcctcgacgatgcgcgggatcggtacgcctccctg
ctcaccggggccaagtatcggcgcaaggcccggatccgggccaccgaactgggggagcga
gccggaatgctcggcgccgcggcgctcgcccgcgatctcggatag

DBGET integrated database retrieval system