KEGG   Tsukamurella paurometabola: Tpau_2675Help
Entry
Tpau_2675         CDS       T01228                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpau_2675
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpau_2675
   00052 Galactose metabolism
    Tpau_2675
   00500 Starch and sucrose metabolism
    Tpau_2675
   00520 Amino sugar and nucleotide sugar metabolism
    Tpau_2675
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tpau_2675
   00524 Butirosin and neomycin biosynthesis
    Tpau_2675
Enzymes [BR:tpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tpau_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2781635..2782579)
Genome map
AA seq 314 aa AA seqDB search
MTQTIGIDIGGTSVRAGVVTDDGTVVDTARAQTPRSARALEECLDRLVQELCADHDVSAV
GLAVAGFLDPARQKVSFAPHLPWRNAAVPAEMSERIGMPVVMEHDANSAAWAEYVFGPAR
RSTVTCVVALGTGIGCGLLIDGQLYRGAFGVAPELGHLQVVPDGRPCDCGKSGCWERYCS
GTALVETAIDLMGPQGSASVLMARELADDPGSLTGRKVAAAAEAGDPVAQEAVADLARWL
GVGLAMVSDVFDPDLIIVSGGVGASSRLFLDDARDRYASLLTGAKYRRKARIRATELGER
AGMLGAAALARDLG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccatcggcatcgacatcggagggacgtcggtgcgggccggcgtggtgacc
gacgacggcaccgtcgtcgacaccgcccgggcgcagaccccgcgcagtgcccgtgcgctc
gaggaatgcctcgaccgcctggtccaggagctgtgcgccgaccacgacgtctccgcggtg
ggcttggcggtggcgggctttctcgacccggctcggcagaaggtctctttcgctccgcat
ctgccctggcgcaatgccgccgttcccgccgagatgagtgagcgcatcggcatgcccgtg
gtgatggagcacgacgccaactcggcggcctgggccgagtacgtcttcggtcccgcccgc
cgcagcacggtgacctgcgtggtggccctcggcaccggcatcggctgcggcctcttgatc
gacgggcagctctaccgcggcgccttcggcgtggctcccgaactcgggcacctgcaagtg
gttcccgacggaaggccttgtgactgtgggaaatccggatgctgggaacggtattgcagc
ggcactgcgctggtggagaccgcgatcgatctgatgggaccgcagggctcggccagcgtg
ctcatggcgcgtgagctcgcagacgacccgggttcgctcaccgggcgcaaggtggccgcg
gccgcagaagccggcgatcccgtcgcccaggaggccgtcgccgatcttgcacgctggctc
ggcgtgggcctggccatggtcagtgatgtcttcgatcccgatctgatcatcgtgtccggt
ggcgtgggagcatcgtcgcggctgttcctcgacgatgcgcgggatcggtacgcctccctg
ctcaccggggccaagtatcggcgcaaggcccggatccgggccaccgaactgggggagcga
gccggaatgctcggcgccgcggcgctcgcccgcgatctcggatag

DBGET integrated database retrieval system