KEGG   Tsukamurella paurometabola: Tpau_2806Help
Entry
Tpau_2806         CDS       T01228                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
tpr  Tsukamurella paurometabola
Brite
Enzymes [BR:tpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     Tpau_2806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADG79404
UniProt: D5UTB9
Position
complement(2905645..2906349)
Genome map
AA seq 234 aa AA seqDB search
MRVEDGLDSSVERLTPTVRRLILLRHGQTASNAEGRMQGQLDTDLTELGRRQAVAAAGAL
ADREPLTIISSDLRRARDTAEALSVATGVGVETDPRLRETMLGEWQGLTHTEVDAYMPGA
RLRWRDAPEWAPPGGEARVDVAARSYPVVTELIDALPEWGEAERPVVLVAHGGLVAALTA
RLLDLPVSSWPVLGGLGNCSWVQLSGHGDAPRWRLDVWNASADVETAAPVPEVQ
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtggaggacgggctcgactcgtcggtcgagcggctcaccccgacggtgcgccgg
ctcatcctgctgcgccacggccagaccgcatcgaacgccgaggggcggatgcagggccag
ctcgacacggatctcaccgagctcggccgcagacaggccgtcgccgcagccggggcgctg
gccgaccgggagccactcaccatcatcagctccgatctgcggcgggcccgcgataccgcc
gaggcgctcagcgtggccaccggtgtcggtgtggagacggacccgcgcctgcgcgagacg
atgctcggcgagtggcagggcctgacccacaccgaggtcgacgcctacatgcccggtgct
cggctgcgctggcgcgatgcccccgagtgggcgccgcccggcggcgaggcccgggtcgac
gtggctgctcggtcgtatcccgtggtcaccgagctcatcgacgccctgcccgaatggggc
gaggcggaacgccccgtggtgctcgtggcgcacggcggcctcgtcgccgccctgaccgcc
cgcctgctggacctgcccgtatcgtcgtggccggtgctcgggggcctcgggaattgcagt
tgggtgcaactcagcggtcacggcgacgcgccccgctggcggctggacgtatggaatgcg
tctgcggacgtcgaaaccgccgcccccgtgcccgaggtccaatga

DBGET integrated database retrieval system