KEGG   Tsukamurella paurometabola: Tpau_2806Help
Entry
Tpau_2806         CDS       T01228                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpau_2806
   01230 Biosynthesis of amino acids
    Tpau_2806
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpau_2806
  Energy metabolism
   00680 Methane metabolism
    Tpau_2806
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpau_2806
Enzymes [BR:tpr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Tpau_2806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2905645..2906349)
Genome map
AA seq 234 aa AA seqDB search
MRVEDGLDSSVERLTPTVRRLILLRHGQTASNAEGRMQGQLDTDLTELGRRQAVAAAGAL
ADREPLTIISSDLRRARDTAEALSVATGVGVETDPRLRETMLGEWQGLTHTEVDAYMPGA
RLRWRDAPEWAPPGGEARVDVAARSYPVVTELIDALPEWGEAERPVVLVAHGGLVAALTA
RLLDLPVSSWPVLGGLGNCSWVQLSGHGDAPRWRLDVWNASADVETAAPVPEVQ
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtggaggacgggctcgactcgtcggtcgagcggctcaccccgacggtgcgccgg
ctcatcctgctgcgccacggccagaccgcatcgaacgccgaggggcggatgcagggccag
ctcgacacggatctcaccgagctcggccgcagacaggccgtcgccgcagccggggcgctg
gccgaccgggagccactcaccatcatcagctccgatctgcggcgggcccgcgataccgcc
gaggcgctcagcgtggccaccggtgtcggtgtggagacggacccgcgcctgcgcgagacg
atgctcggcgagtggcagggcctgacccacaccgaggtcgacgcctacatgcccggtgct
cggctgcgctggcgcgatgcccccgagtgggcgccgcccggcggcgaggcccgggtcgac
gtggctgctcggtcgtatcccgtggtcaccgagctcatcgacgccctgcccgaatggggc
gaggcggaacgccccgtggtgctcgtggcgcacggcggcctcgtcgccgccctgaccgcc
cgcctgctggacctgcccgtatcgtcgtggccggtgctcgggggcctcgggaattgcagt
tgggtgcaactcagcggtcacggcgacgcgccccgctggcggctggacgtatggaatgcg
tctgcggacgtcgaaaccgccgcccccgtgcccgaggtccaatga

DBGET integrated database retrieval system