KEGG   Tsukamurella paurometabola: Tpau_2831Help
Entry
Tpau_2831         CDS       T01228                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tpr  Tsukamurella paurometabola
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Tpau_2831
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tpau_2831
   00650 Butanoate metabolism
    Tpau_2831
  Lipid metabolism
   00071 Fatty acid degradation
    Tpau_2831
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tpau_2831
   00310 Lysine degradation
    Tpau_2831
   00360 Phenylalanine metabolism
    Tpau_2831
   00380 Tryptophan metabolism
    Tpau_2831
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tpau_2831
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tpau_2831
   00281 Geraniol degradation
    Tpau_2831
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tpau_2831
   00627 Aminobenzoate degradation
    Tpau_2831
   00930 Caprolactam degradation
    Tpau_2831
Enzymes [BR:tpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tpau_2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2932003..2932791
Genome map
AA seq 262 aa AA seqDB search
MTDAPLVRYEVRDGAAYLTIDSPHNRNAISQRLLTDLRAGIDRAGIDDTVRAVVLTHDGG
TFCAGADLKEAAASGAGSDPKSRTLAMIDAMRGVIESPKPVIAQVNGHVRAGGFGLIGSC
DFVFAGPESTFAVTETRIGVAPAMVSLVLLPHLPSRVASSLLLTGRKFDAIEAASHGLIT
AAVDDPEAAVADQLAELRLCSPQGLRETKQILWHDVLASFDERANALGDQSARLFGSPES
VEGMTAFLQKRAPSWAEPAAAH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgctcccctggtgcggtacgaggtacgcgacggcgccgcatacctcacgatc
gacagcccgcacaaccgcaacgcgatctcgcagcggctgctcaccgacctgcgggccggt
atcgaccgcgcaggtatcgatgacaccgtccgcgccgtggtactcacccacgacggcggg
accttctgcgccggtgccgatctcaaggaagcggccgcgagcggtgcgggatcggacccg
aagtcgcgcacgctcgccatgatcgatgcgatgcggggtgtcatcgaatctcccaagccg
gtgatcgcacaggtgaacggccacgtccgggcaggcggcttcggcctcatcggttcctgc
gatttcgtcttcgccggaccggagtcgaccttcgccgttaccgagacccgaatcggcgtg
gcacccgcgatggtctcgctggtactgctgccgcaccttccctcgcgcgtcgcctcgtca
ctgctgctcaccggtaggaagttcgacgcgatcgaggcggcgagccacggcctgatcacc
gctgcggtcgacgatcccgaggccgcggtggcggatcagctcgctgaactgcgactgtgc
agcccgcagggtctgcgcgagaccaagcagatcctgtggcacgacgtgctcgcctcgttc
gacgagcgggccaacgccctgggcgaccagtcggctcgcctgttcggctcgcccgaatcg
gtggaaggcatgaccgcgttcctgcagaagcgcgcgccgagctgggccgagcccgcggcc
gcgcactag

DBGET integrated database retrieval system