KEGG   Tsukamurella paurometabola: Tpau_2831Help
Entry
Tpau_2831         CDS       T01228                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00071  Fatty acid degradation
tpr00280  Valine, leucine and isoleucine degradation
tpr00281  Geraniol degradation
tpr00310  Lysine degradation
tpr00360  Phenylalanine metabolism
tpr00362  Benzoate degradation
tpr00380  Tryptophan metabolism
tpr00410  beta-Alanine metabolism
tpr00627  Aminobenzoate degradation
tpr00640  Propanoate metabolism
tpr00650  Butanoate metabolism
tpr00903  Limonene and pinene degradation
tpr00930  Caprolactam degradation
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01130  Biosynthesis of antibiotics
tpr01212  Fatty acid metabolism
Module
tpr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tpau_2831
   00650 Butanoate metabolism
    Tpau_2831
  Lipid metabolism
   00071 Fatty acid degradation
    Tpau_2831
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tpau_2831
   00310 Lysine degradation
    Tpau_2831
   00360 Phenylalanine metabolism
    Tpau_2831
   00380 Tryptophan metabolism
    Tpau_2831
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tpau_2831
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tpau_2831
   00281 Geraniol degradation
    Tpau_2831
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tpau_2831
   00627 Aminobenzoate degradation
    Tpau_2831
   00930 Caprolactam degradation
    Tpau_2831
Enzymes [BR:tpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tpau_2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADG79429
UniProt: D5UTE4
Position
2932003..2932791
Genome map
AA seq 262 aa AA seqDB search
MTDAPLVRYEVRDGAAYLTIDSPHNRNAISQRLLTDLRAGIDRAGIDDTVRAVVLTHDGG
TFCAGADLKEAAASGAGSDPKSRTLAMIDAMRGVIESPKPVIAQVNGHVRAGGFGLIGSC
DFVFAGPESTFAVTETRIGVAPAMVSLVLLPHLPSRVASSLLLTGRKFDAIEAASHGLIT
AAVDDPEAAVADQLAELRLCSPQGLRETKQILWHDVLASFDERANALGDQSARLFGSPES
VEGMTAFLQKRAPSWAEPAAAH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgctcccctggtgcggtacgaggtacgcgacggcgccgcatacctcacgatc
gacagcccgcacaaccgcaacgcgatctcgcagcggctgctcaccgacctgcgggccggt
atcgaccgcgcaggtatcgatgacaccgtccgcgccgtggtactcacccacgacggcggg
accttctgcgccggtgccgatctcaaggaagcggccgcgagcggtgcgggatcggacccg
aagtcgcgcacgctcgccatgatcgatgcgatgcggggtgtcatcgaatctcccaagccg
gtgatcgcacaggtgaacggccacgtccgggcaggcggcttcggcctcatcggttcctgc
gatttcgtcttcgccggaccggagtcgaccttcgccgttaccgagacccgaatcggcgtg
gcacccgcgatggtctcgctggtactgctgccgcaccttccctcgcgcgtcgcctcgtca
ctgctgctcaccggtaggaagttcgacgcgatcgaggcggcgagccacggcctgatcacc
gctgcggtcgacgatcccgaggccgcggtggcggatcagctcgctgaactgcgactgtgc
agcccgcagggtctgcgcgagaccaagcagatcctgtggcacgacgtgctcgcctcgttc
gacgagcgggccaacgccctgggcgaccagtcggctcgcctgttcggctcgcccgaatcg
gtggaaggcatgaccgcgttcctgcagaagcgcgcgccgagctgggccgagcccgcggcc
gcgcactag

DBGET integrated database retrieval system