KEGG   Tsukamurella paurometabola: Tpau_2871Help
Entry
Tpau_2871         CDS       T01228                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpau_2871
   01230 Biosynthesis of amino acids
    Tpau_2871
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpau_2871
   00030 Pentose phosphate pathway
    Tpau_2871
   00051 Fructose and mannose metabolism
    Tpau_2871
   00052 Galactose metabolism
    Tpau_2871
  Energy metabolism
   00680 Methane metabolism
    Tpau_2871
Enzymes [BR:tpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tpau_2871
Protein phosphatases and associated proteins [BR:tpr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tpau_2871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2979366..2980403)
Genome map
AA seq 345 aa AA seqDB search
MSLRIGVLTGGGDCPGLNAVIRAVVRTCDSRYGSSVVGFQDGWRGLLENRRIHLANDDRN
DRLLTKGGTMLGTARTHPDVLRDGLPQIKQTLDDNGIDVLIPIGGEGTLTAASWLADEGV
PVVGVPKTIDNDIDCTDVTFGFDTALTIATDAIDRLHSTAESHQRVMLVEVMGRHAGWIA
LNSGLASGAHMILIPEVPFDVEELCRLIKRRFQRGHSSFIVVVAEGAKPAEGSMELRVGG
TDEFGHERFTGVAHQLGVEIEKRINKEVRTTVLGHVQRGGTPTPHDRVLATRYGVNAADA
AHAGKTGQMVSLRGTTVGLVPLAEAVKQLKRVPRERYDDAAEFFG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcgaatcggagtcctgaccggcggtggcgattgccccggcctcaacgcggtg
atccgtgctgtggtgcgcacctgcgattcccgctacggctcctcggtggtgggtttccag
gacggctggcgcggcctgctcgagaaccggcgcatccatctcgccaacgacgaccgcaac
gaccgtctgctcaccaagggtggcaccatgctcggtaccgcccgtacccaccccgacgtg
ctccgcgacggcctcccgcagatcaagcaaacgctggacgacaacggaatcgacgtgctg
atcccgatcggcggcgagggaacgctcaccgccgcgtcctggctcgccgacgagggcgtc
cccgtggtcggcgtgccgaagaccatcgacaacgacatcgactgcaccgacgtcaccttc
ggcttcgacaccgcgctgaccatcgccaccgacgccatcgaccggctgcattcgaccgcc
gaatcccatcagcgggtgatgctggtcgaggtgatgggccggcacgccggctggatcgcg
ctgaactccggactcgcctcgggggcgcacatgatcctcatccccgaggtgcccttcgac
gtcgaggagctgtgccggctcatcaagcggcgattccagcgaggacactccagcttcatc
gtggtggtcgccgagggcgccaaacccgctgaggggtcgatggagcttcgggttggcggc
accgatgaattcggccacgaacgattcaccggggtcgcgcaccagctgggcgtcgagatc
gagaagcggatcaacaaggaggtccgcaccacggtcctcggccacgtgcagcgcggcggt
actccgacaccgcacgaccgcgtcctggccacccgctacggcgtgaacgccgccgacgcc
gcgcacgccgggaagacgggccagatggtgtcgctgcgcggcaccacggtcgggctggtt
ccgctcgccgaggcggtcaagcagctcaagcgggtgccgcgcgagcggtacgacgacgcc
gcggagttcttcggctga

DBGET integrated database retrieval system