KEGG   Tsukamurella paurometabola: Tpau_2871Help
Entry
Tpau_2871         CDS       T01228                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00010  Glycolysis / Gluconeogenesis
tpr00030  Pentose phosphate pathway
tpr00051  Fructose and mannose metabolism
tpr00052  Galactose metabolism
tpr00680  Methane metabolism
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpau_2871
   00030 Pentose phosphate pathway
    Tpau_2871
   00051 Fructose and mannose metabolism
    Tpau_2871
   00052 Galactose metabolism
    Tpau_2871
  Energy metabolism
   00680 Methane metabolism
    Tpau_2871
Enzymes [BR:tpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tpau_2871
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Tpau_2871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADG79469
UniProt: D5UTI4
Position
complement(2979366..2980403)
Genome map
AA seq 345 aa AA seqDB search
MSLRIGVLTGGGDCPGLNAVIRAVVRTCDSRYGSSVVGFQDGWRGLLENRRIHLANDDRN
DRLLTKGGTMLGTARTHPDVLRDGLPQIKQTLDDNGIDVLIPIGGEGTLTAASWLADEGV
PVVGVPKTIDNDIDCTDVTFGFDTALTIATDAIDRLHSTAESHQRVMLVEVMGRHAGWIA
LNSGLASGAHMILIPEVPFDVEELCRLIKRRFQRGHSSFIVVVAEGAKPAEGSMELRVGG
TDEFGHERFTGVAHQLGVEIEKRINKEVRTTVLGHVQRGGTPTPHDRVLATRYGVNAADA
AHAGKTGQMVSLRGTTVGLVPLAEAVKQLKRVPRERYDDAAEFFG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcgaatcggagtcctgaccggcggtggcgattgccccggcctcaacgcggtg
atccgtgctgtggtgcgcacctgcgattcccgctacggctcctcggtggtgggtttccag
gacggctggcgcggcctgctcgagaaccggcgcatccatctcgccaacgacgaccgcaac
gaccgtctgctcaccaagggtggcaccatgctcggtaccgcccgtacccaccccgacgtg
ctccgcgacggcctcccgcagatcaagcaaacgctggacgacaacggaatcgacgtgctg
atcccgatcggcggcgagggaacgctcaccgccgcgtcctggctcgccgacgagggcgtc
cccgtggtcggcgtgccgaagaccatcgacaacgacatcgactgcaccgacgtcaccttc
ggcttcgacaccgcgctgaccatcgccaccgacgccatcgaccggctgcattcgaccgcc
gaatcccatcagcgggtgatgctggtcgaggtgatgggccggcacgccggctggatcgcg
ctgaactccggactcgcctcgggggcgcacatgatcctcatccccgaggtgcccttcgac
gtcgaggagctgtgccggctcatcaagcggcgattccagcgaggacactccagcttcatc
gtggtggtcgccgagggcgccaaacccgctgaggggtcgatggagcttcgggttggcggc
accgatgaattcggccacgaacgattcaccggggtcgcgcaccagctgggcgtcgagatc
gagaagcggatcaacaaggaggtccgcaccacggtcctcggccacgtgcagcgcggcggt
actccgacaccgcacgaccgcgtcctggccacccgctacggcgtgaacgccgccgacgcc
gcgcacgccgggaagacgggccagatggtgtcgctgcgcggcaccacggtcgggctggtt
ccgctcgccgaggcggtcaagcagctcaagcgggtgccgcgcgagcggtacgacgacgcc
gcggagttcttcggctga

DBGET integrated database retrieval system