KEGG   Tsukamurella paurometabola: Tpau_2919Help
Entry
Tpau_2919         CDS       T01228                                 

Definition
glycoside hydrolase family protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tpr  Tsukamurella paurometabola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tpau_2919
Enzymes [BR:tpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Tpau_2919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3028517..3030055
Genome map
AA seq 512 aa AA seqDB search
MTGSPREPGMIAVVLHSHLPWLAHHGAWPVGEEWLYQSWAASYLRVAEVLDRLADEGRTE
QLTLGITPVLAAQLDDPYCLEAMHHYLGNWQLRAHEAALSGRPASAELGAREHRNAAHAL
RLFESQWRHGGTPVLRRLADAGTVELLGGPLAHPFQPLLHPRLRELSLREGLAYGKARLG
QDPAGIWAPECAYAPGMEHGYQAAGVTHFMVDGPTLGGDTALARPVGDSTVLAFGRDLPV
SYRVWSPKSGYPGHAAYRDFYAHDHSTGLKPSRVTGKNVPEQEKAPYDPQRADAAIDKHV
ADFVETVVQRLRSESSRIGRDALVVAAFDTELFGHWWYEGPIWLERVLRALPEAGVRVGT
LRSAAEAGYVGAPREIAASSWGSGKDWRVWEGPQVREFVELNEEITTTTLRVLDKRAGRQ
RDRVSDQVLQEALMCLQSDWPFMVSKDTAAAYARDRAYKHAHALREIADAAERGDEARAA
MLARSWRQADDPFPGLDARRLPPARLDPVGGF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggaagccctcgcgaacccgggatgatcgccgtcgtcctgcattcgcacctgccg
tggctcgcgcaccacggcgcgtggccggtcggcgaggagtggctctaccaatcgtgggcg
gcgtcctatctccgcgtcgcagaggtactcgaccggctcgccgacgagggccgcaccgag
cagctgaccctcgggatcacccccgtgctcgccgcccagctcgacgacccctactgcctc
gaagccatgcaccactacctcggcaactggcagttgcgggcacacgaggcggccctgtcc
ggccggcccgcgagcgcggaactcggtgcacgcgaacaccgtaacgccgcgcacgcgctg
cgtctcttcgaatcgcagtggcggcacggcgggaccccggtgctgcgccgtctcgccgat
gcgggcaccgtcgaactgctcggcggaccgctcgcgcaccccttccaaccgctcttgcac
ccgaggctccgcgagttgtcgctgcgcgagggcctcgcgtacggcaaggcccgtctcggt
caggatccggccggcatctgggctcccgagtgcgcgtacgcacccggcatggaacacggg
taccaggccgcgggcgtcacccacttcatggtcgacgggcccaccctggggggcgatacc
gcgctggctcgcccggtgggcgattcgacggtgctggccttcggccgcgaccttccggtg
agctaccgcgtctggtcaccgaaatccgggtatcccgggcacgccgcctaccgcgacttc
tacgcgcacgatcactcgaccggcctcaagccgagccgggtgacgggcaagaacgtgccc
gagcaggagaaggccccgtacgacccgcagcgcgccgacgccgcgatcgacaaacacgtc
gccgacttcgtggagaccgtggtgcagcgcctccggtccgagagctcccggatcggccgc
gacgccctggtcgtggcggctttcgacaccgagctgttcgggcactggtggtacgagggc
ccgatctggctggaacgggtgctgcgcgcgctgcccgaggccggtgtgcgagtaggcacg
ctgcgctcggccgccgaagccgggtacgtgggtgctccgcgtgagatcgctgccagctcc
tggggatccggtaaggactggcgggtctgggagggcccgcaggtgcgcgagttcgtcgag
ctcaatgaggagatcaccacgacgacgctgcgggtgctcgacaagcgcgccgggcggcag
cgcgaccgcgtcagcgaccaggtcctgcaggaggcactcatgtgcctgcaatccgattgg
ccgttcatggtctcgaaggacaccgccgccgcgtacgcccgcgaccgcgcctacaagcat
gcgcacgccctgcgcgagatcgccgacgccgccgagcgcggcgacgaggcgcgcgcggcg
atgctcgcccgaagctggcgccaggccgacgatccgttccccggcctcgacgcccgtcgt
cttccgcccgcacggctcgatcccgtgggagggttctga

DBGET integrated database retrieval system