KEGG   Tsukamurella paurometabola: Tpau_2920Help
Entry
Tpau_2920         CDS       T01228                                 

Definition
group 1 glycosyl transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tpr  Tsukamurella paurometabola
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tpau_2920
Enzymes [BR:tpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Tpau_2920
Glycosyltransferases [BR:tpr01003]
 Polysaccharide
  Storage polysaccharide
   Tpau_2920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3030055..3031362
Genome map
AA seq 435 aa AA seqDB search
MRVLLVSWEYPPVVVGGLGRHVHHLALQLRDQGHDVVVLSRQPTGTDPRSNPTSDQRIDG
IRVIMAAEDPLALEFGTDMMPWVLSMGHSMLRAGLRLAGFNPTAGEDVGHGAGTVGRPWV
PDVVHAHDWLAAHAAVGLAEAFDAPLVATIHATEAGRHSGWVSGPVNRQVHSTEWWLANE
ADAVITCSRSMSDEVNRLFGPGIAQLHTIANGIDVELWPYRDRAIVSARSGPPRLLYVGR
LEYEKGVQDLIAALARVRRTHPGTTLTIAGDGTQAEWLRGVAREQKVMRAVEFTGALDHD
ELVAQLHSADALVIPSRYEPFGIVALEGAATGIPIIATTAGGLADFIRAGETGVSVDPAD
VAGLTAAIRGVLDDPVSAHRWAAAARSEVEALTWEAVAGETAQVYLAAKRRPRNPLGRRV
IDERPLPERDPTNPL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttctgctcgtctcctgggagtacccgcccgtggtggtcggcggcctcggccgg
catgtgcaccacctcgcgctgcaactacgcgaccagggccacgacgtggtggtcctctca
cgtcagcccaccggcaccgatccgcgcagcaaccccacctccgatcagcggatcgacggc
atccgcgtgatcatggccgccgaggaccccttggcattggaattcggcaccgacatgatg
ccgtgggtgttgtcgatgggacattcgatgctgcgggcgggactgcggctggccggtttc
aacccgacagccggcgaagacgtgggccatggcgccggcaccgtcggccgcccctgggta
cccgatgtggtgcacgcccacgactggctggcagcgcacgctgcggtcggtctcgcggag
gccttcgacgctccgctggtcgcgacgatccacgcgaccgaggcgggccggcacagcggc
tgggtctcgggaccggtgaaccggcaggtgcattcgaccgaatggtggctcgcgaacgaa
gcggatgcggtgatcacctgctcgcgatcgatgtcggacgaagtgaaccggctcttcggc
cccggcatcgcgcaactgcacaccatcgccaacggcatcgacgtcgagttgtggccctac
cgggaccgcgccatcgtcagcgcccggtcggggccgccccgcctgctgtacgttggccgg
ctcgaatacgagaagggcgtacaggacctcatcgcagcgctcgcccgggtgcgccgcacc
catcccggcaccaccctcaccatcgccggcgacggtacccaggcggagtggctgcgcggc
gtcgcgcgggagcagaaggtgatgcgcgcggtggagttcaccggggcgctcgatcacgac
gagctggtggcacagttgcattcggccgatgccctggtgatcccgtcgcgctacgagccg
ttcgggatcgtcgcgctggagggggccgccaccggcatcccgatcatcgctaccaccgcc
ggcggactggccgatttcatccgggccggcgagaccggtgtctcggtggatcccgccgac
gtggccggtctcaccgccgcgatccgcggggtactcgacgatccggtttccgcacatcgg
tgggcggcggccgcccggtccgaggtggaggcgctcacgtgggaagccgtcgccggggag
accgcgcaggtgtatctcgcggcgaagcgccgcccacgcaatccgctggggcgaagggtg
atcgacgagcgcccgctgcccgaacgggatcccaccaatccgctctga

DBGET integrated database retrieval system