KEGG   Tsukamurella paurometabola: Tpau_3071Help
Entry
Tpau_3071         CDS       T01228                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tpr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tpr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tpr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tpr00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:tpr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3185863..3187542
Genome map
AA seq 559 aa AA seqDB search
MTSAQGYRDFLAARDLLVELAEDYDAAREQFAWPQLDEWNFALDWFDRVAENNDAPALWI
VEEDGSESKFSYAQMSTRSNRVANWLRERGVNPGDRILLMLSNQVELWDVMLAAIKLGAV
VIPATTLLAEADIADRIARGGAKHVIVRSELADRVPADADVSRIVIGSPVPGWETFASAY
TASEKFTPTHTTHADDSLLLYFTSGTTSAPKLVEHTHASYPVGHLSTMYWIGLRPGDVHL
NVSSPGWAKHAWSNVFTPWIAQACVFIYNYNRFDAAALMSQMQRAGVTSFCAPPTVWRML
IQADLGALTSPPRVVVGAGEPLNPEVISRVRDAWGVTIRDGFGQTETTVQVANTPGQQLK
DGSMGRPCPGYDVVLVDPATGEQGVDEGEICLRLDPRPLGLMVGYHGDPEKTAKVMEGGV
YHTGDVASRDAEGYLTYVGRTDDVFKSSDYKISPFELESVLLEHEAVAEAAIVPAPDELR
LAVPKAYIVLAEGYAPTDETARSIFDYSRGHLAPYKRVRRIAFADLPKTISGKIRRVELR
KAEEQGLTSQEFREDDVKA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtgcacaggggtatcgggacttcctggccgcgcgcgacctgctcgtggagctc
gcggaggactacgacgcggcccgtgagcagttcgcctggccgcagctcgacgagtggaat
ttcgccctggactggttcgaccgggtggccgagaacaacgacgcaccggcactgtggatc
gtcgaggaggacggatccgagtcgaagttcagctacgcccagatgagcacccgcagcaat
cgggtggccaattggctccgggagcgtggcgtgaacccgggcgatcgcattctcctgatg
ctgagcaaccaggtggaactgtgggacgtcatgctcgcagccatcaaactgggtgcggtg
gtcatccccgccaccacgctgctcgcggaggccgatatcgccgaccgcatcgctcggggc
ggcgccaagcacgtgatcgtgcgcagcgagctggccgaccgcgtgcccgccgatgccgat
gtgagccgcatcgtcatcggctcgccggttcccggttgggagaccttcgcgtccgcgtac
accgcctccgagaagttcacccccacgcacaccacgcacgccgacgacagcctcctgctc
tacttcacctcgggcaccaccagcgcgcccaagctggtcgagcacacccatgcgtcgtac
cccgtcgggcacctgtccacgatgtactggatcggcctgcgccccggcgacgtgcacctc
aacgtgagctcccccggctgggccaaacacgcatggagcaatgtcttcaccccctggatc
gcccaggcgtgtgtgttcatctacaactacaaccggttcgacgcggcagccctcatgagc
cagatgcagcgcgccggtgtgaccagcttctgcgcaccgcccacggtgtggcgcatgctg
atccaggccgatctcggcgcgctgacgtcaccaccccgggtggttgtgggcgccggcgaa
ccgctcaatcccgaggtgatctcgcgggtccgcgatgcctggggcgtcaccatccgtgac
ggcttcggccagaccgagaccaccgtccaggtggcgaacacgcccggccagcagctcaag
gacggttccatgggccgcccgtgccccggctacgacgtggttctcgtcgatcccgcgacc
ggcgaacagggtgtcgacgagggcgagatctgtctgcggctcgatccgcggcccctcggc
ctgatggtgggataccacggcgacccggagaagaccgcgaaggtgatggagggcggggtt
tatcacaccggcgatgtggcctcacgcgatgcggagggctacctgacctacgtgggccgc
accgacgacgtgttcaaatcgagcgactacaagatcagtcctttcgagctggaatcggtt
ctgctggaacatgaggcggtcgccgaagcggcgatcgtcccggcacccgacgagctgcgg
ctcgcggtcccgaaggcgtacatcgtgctcgccgaggggtacgcacccaccgatgagacc
gcgcggtcgatcttcgactacagccgcggacacctggccccctacaagcgcgtgcgccgg
atcgccttcgccgacctgccgaagacgatcagtggcaagatccgccgggtggagttgcgc
aaggccgaggagcagggcctcacctcgcaggagttccgcgaggacgacgtcaaggcgtga

DBGET integrated database retrieval system