KEGG   Tsukamurella paurometabola: Tpau_3448Help
Entry
Tpau_3448         CDS       T01228                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:tpr01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tpr00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:tpr00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:tpr00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:tpr00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:tpr00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3532754..3533869
Genome map
AA seq 371 aa AA seqDB search
MRIRGAVLEEIGRARPYSDSHPITVSELDLADPGPGEVLVRIEAAGLCHSDLSVVDGNRV
RPVPMLLGHEAAGIVESLGTGVSGLSVGDRVVMAFLPRCGECAHCRTDGQLPCTPGSAAN
NAGELLGGGRRLSRDGEPIQHHLGVSGFATHAVVDARSVTRVDADVPPDIAAVLGCAVLT
GGGAVLNAGTPTDGDDVIVIGLGGVGMAAVLTALSLKADGAVGRVIGVDAQPAKLEQVRA
LGADAAYTPAELTKAGVRAPVVIEAAGHPRAFESAVAATAVGGKTVTVGLPNPGARSEIS
PLVLTAEARTIIGSYLGSAVPQRDIPRYVELWRAGKLPVEKLISGVITLDQINEGMDALA
DGTAVRQIITF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccgcggggccgtgctggaggagatcggcagggccaggccctattccgactca
catccgatcaccgtgtccgagctcgacctggctgatccgggcccgggcgaggtgctggtg
cgcatcgaggccgcgggcctgtgccactccgacctctcggtggtggacggtaaccgggtg
cggcctgttccgatgctgctgggacacgaggcggccggcatcgtcgaatcgctcggcacg
ggtgtttccggtctgtccgtcggcgatcgtgtggtgatggccttccttccccgctgcgga
gaatgcgctcattgccgtacggacggccaacttccgtgcacgccgggcagcgccgcgaac
aatgcgggcgagctgctgggcggcggccgtcgactgtcccgcgacggcgagccgatccag
caccacctcggcgtctcggggttcgcgacgcacgccgtggtcgatgcgcgctcggtgacc
cgcgtggatgccgacgtgccgccggacatcgccgccgtcctcggctgcgcggtgctcacc
ggcggtggggccgtgctcaatgccggcacacccaccgacggcgacgatgtgatcgtgatc
ggtctgggcggcgtcggcatggccgccgtgctcaccgccctgtcgctcaaggccgacggt
gccgtcggccgcgtgatcggggtggacgcgcagcccgcgaaactggagcaggtgcgcgca
ctcggtgcggatgccgcctacacccctgcggaattgactaaagccggggtgcgcgcgccg
gtggtgatcgaggccgccgggcaccctcgggcgttcgaatccgcggtggcggcgaccgcc
gtcggcgggaagacggtgaccgtcggcctaccgaatcccggtgcgcgctcggagatcagc
ccgctggtgctcaccgccgaggcccgcaccattatcggcagctatctgggatcggctgtg
ccgcagcgcgatatcccgcgctacgtcgagctgtggcgagccgggaagctaccggtcgag
aagctgatctccggtgtgatcaccctcgatcagatcaacgagggcatggacgccctcgcc
gacggcaccgccgtccgccagatcatcaccttctga

DBGET integrated database retrieval system