KEGG   Tsukamurella paurometabola: Tpau_3448Help
Entry
Tpau_3448         CDS       T01228                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tpau_3448
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpau_3448
  Lipid metabolism
   00071 Fatty acid degradation
    Tpau_3448
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tpau_3448
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tpau_3448
   00626 Naphthalene degradation
    Tpau_3448
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tpau_3448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3532754..3533869
Genome map
AA seq 371 aa AA seqDB search
MRIRGAVLEEIGRARPYSDSHPITVSELDLADPGPGEVLVRIEAAGLCHSDLSVVDGNRV
RPVPMLLGHEAAGIVESLGTGVSGLSVGDRVVMAFLPRCGECAHCRTDGQLPCTPGSAAN
NAGELLGGGRRLSRDGEPIQHHLGVSGFATHAVVDARSVTRVDADVPPDIAAVLGCAVLT
GGGAVLNAGTPTDGDDVIVIGLGGVGMAAVLTALSLKADGAVGRVIGVDAQPAKLEQVRA
LGADAAYTPAELTKAGVRAPVVIEAAGHPRAFESAVAATAVGGKTVTVGLPNPGARSEIS
PLVLTAEARTIIGSYLGSAVPQRDIPRYVELWRAGKLPVEKLISGVITLDQINEGMDALA
DGTAVRQIITF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccgcggggccgtgctggaggagatcggcagggccaggccctattccgactca
catccgatcaccgtgtccgagctcgacctggctgatccgggcccgggcgaggtgctggtg
cgcatcgaggccgcgggcctgtgccactccgacctctcggtggtggacggtaaccgggtg
cggcctgttccgatgctgctgggacacgaggcggccggcatcgtcgaatcgctcggcacg
ggtgtttccggtctgtccgtcggcgatcgtgtggtgatggccttccttccccgctgcgga
gaatgcgctcattgccgtacggacggccaacttccgtgcacgccgggcagcgccgcgaac
aatgcgggcgagctgctgggcggcggccgtcgactgtcccgcgacggcgagccgatccag
caccacctcggcgtctcggggttcgcgacgcacgccgtggtcgatgcgcgctcggtgacc
cgcgtggatgccgacgtgccgccggacatcgccgccgtcctcggctgcgcggtgctcacc
ggcggtggggccgtgctcaatgccggcacacccaccgacggcgacgatgtgatcgtgatc
ggtctgggcggcgtcggcatggccgccgtgctcaccgccctgtcgctcaaggccgacggt
gccgtcggccgcgtgatcggggtggacgcgcagcccgcgaaactggagcaggtgcgcgca
ctcggtgcggatgccgcctacacccctgcggaattgactaaagccggggtgcgcgcgccg
gtggtgatcgaggccgccgggcaccctcgggcgttcgaatccgcggtggcggcgaccgcc
gtcggcgggaagacggtgaccgtcggcctaccgaatcccggtgcgcgctcggagatcagc
ccgctggtgctcaccgccgaggcccgcaccattatcggcagctatctgggatcggctgtg
ccgcagcgcgatatcccgcgctacgtcgagctgtggcgagccgggaagctaccggtcgag
aagctgatctccggtgtgatcaccctcgatcagatcaacgagggcatggacgccctcgcc
gacggcaccgccgtccgccagatcatcaccttctga

DBGET integrated database retrieval system