KEGG   Tsukamurella paurometabola: Tpau_3499Help
Entry
Tpau_3499         CDS       T01228                                 

Definition
D-amino-acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tpr00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tpr00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:tpr00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:tpr00311]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3610342..3611259)
Genome map
AA seq 305 aa AA seqDB search
MSDVTVVGAGVIGLSCAVRLLEAGHTVRVYGRDLAPDLTSAVAAAVWEPYLVEPRDRVAG
WSAAALAEFTSLAERGADGVVMTSGTEIFRQPVGEPWWSVAVPEVHRVAEPRPGYAEGWS
FVAPVIEMPIYLPWLAGRVCELGGTVEQRTVTSLDDLDGPIVNATGLGARDLVGDASMEA
VRGQVVYLEQIGLDRWWIDDSSLDSGVTTYVIPRSRDIVVGGTEDHGAEDLTVDPVTAEA
IVERARTLVPELAGARVIGHNIGLRPARPTVRLERVGEVVHCYGHGGAGVTLSWGCADEV
TALIG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgatgtgacggtggtgggcgccggtgtgatcgggttgtcctgtgcggtgcggttg
ttggaagccgggcataccgtacgggtatacggccgcgacctcgcccccgacctcacctcc
gccgttgctgcggcggtctgggagccctacctcgtcgaaccgcgcgaccgggtcgccggc
tggtcggccgccgcgctcgccgagttcacctccctcgccgagcgcggagccgacggcgtg
gtgatgacatccggcactgagatcttccggcagccggtgggagagccgtggtggagcgtt
gcggttcccgaggtgcaccgggtcgccgagccccgccccggctacgcggagggctggagc
ttcgtcgcgcccgtgatcgagatgccgatctacctgccgtggctcgccgggcgggtgtgt
gagctgggcggcaccgtcgaacagcggaccgtgacttcgctcgacgacctcgacgggccg
atcgtcaacgccaccggtctcggcgcccgtgatctcgtgggcgacgcgtcgatggaagcc
gtacgtgggcaggtcgtctatctcgaacagatcggactggaccgctggtggatcgacgac
tcctctctcgactccggcgtgaccacctacgtcatcccgcgcagccgcgacatcgtggtc
ggcggcaccgaggaccacggtgccgaagacctgaccgtcgacccggtgaccgccgaggcc
atcgtcgagcgcgcccgcacccttgttcccgaactcgccggggcgcgggtgatcgggcac
aacatcggcttgcgcccggctcggccgacggtccgcctcgaacgcgtgggcgaggtggtc
cactgctacggccacggcggcgccggcgtcaccctgagctggggttgtgccgacgaggtg
acggcactgatcggctga

DBGET integrated database retrieval system