KEGG   Tsukamurella paurometabola: Tpau_3499Help
Entry
Tpau_3499         CDS       T01228                                 

Definition
D-amino-acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpau_3499
   00330 Arginine and proline metabolism
    Tpau_3499
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Tpau_3499
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Tpau_3499
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Tpau_3499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3610342..3611259)
Genome map
AA seq 305 aa AA seqDB search
MSDVTVVGAGVIGLSCAVRLLEAGHTVRVYGRDLAPDLTSAVAAAVWEPYLVEPRDRVAG
WSAAALAEFTSLAERGADGVVMTSGTEIFRQPVGEPWWSVAVPEVHRVAEPRPGYAEGWS
FVAPVIEMPIYLPWLAGRVCELGGTVEQRTVTSLDDLDGPIVNATGLGARDLVGDASMEA
VRGQVVYLEQIGLDRWWIDDSSLDSGVTTYVIPRSRDIVVGGTEDHGAEDLTVDPVTAEA
IVERARTLVPELAGARVIGHNIGLRPARPTVRLERVGEVVHCYGHGGAGVTLSWGCADEV
TALIG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgatgtgacggtggtgggcgccggtgtgatcgggttgtcctgtgcggtgcggttg
ttggaagccgggcataccgtacgggtatacggccgcgacctcgcccccgacctcacctcc
gccgttgctgcggcggtctgggagccctacctcgtcgaaccgcgcgaccgggtcgccggc
tggtcggccgccgcgctcgccgagttcacctccctcgccgagcgcggagccgacggcgtg
gtgatgacatccggcactgagatcttccggcagccggtgggagagccgtggtggagcgtt
gcggttcccgaggtgcaccgggtcgccgagccccgccccggctacgcggagggctggagc
ttcgtcgcgcccgtgatcgagatgccgatctacctgccgtggctcgccgggcgggtgtgt
gagctgggcggcaccgtcgaacagcggaccgtgacttcgctcgacgacctcgacgggccg
atcgtcaacgccaccggtctcggcgcccgtgatctcgtgggcgacgcgtcgatggaagcc
gtacgtgggcaggtcgtctatctcgaacagatcggactggaccgctggtggatcgacgac
tcctctctcgactccggcgtgaccacctacgtcatcccgcgcagccgcgacatcgtggtc
ggcggcaccgaggaccacggtgccgaagacctgaccgtcgacccggtgaccgccgaggcc
atcgtcgagcgcgcccgcacccttgttcccgaactcgccggggcgcgggtgatcgggcac
aacatcggcttgcgcccggctcggccgacggtccgcctcgaacgcgtgggcgaggtggtc
cactgctacggccacggcggcgccggcgtcaccctgagctggggttgtgccgacgaggtg
acggcactgatcggctga

DBGET integrated database retrieval system