KEGG   Tsukamurella paurometabola: Tpau_3617Help
Entry
Tpau_3617         CDS       T01228                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00480  Glutathione metabolism
tpr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Tpau_3617
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Tpau_3617
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Tpau_3617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ADG80195
UniProt: D5UXV8
Position
complement(3732137..3732628)
Genome map
AA seq 163 aa AA seqDB search
MTALDSIALTSLDGSATSLAEYAGRAVLVVNVASKCGLTPQYAGLEALATRYADRGLTVL
GVPCNQFAGQEPGSAEEIATFCSTTYGVTFPLLEKTDVNGDARHPLYVELATTPDAEGEA
GDITWNFEKFLIAPDHVTVQRFRPRTEPESDEVVGAIEAVLPS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccctggattccatcgctctgacctctctcgacggttccgccacctcgctcgcc
gagtacgcgggacgcgccgtgctggtggtgaacgtggccagcaagtgcgggctgaccccg
caatacgcgggcctggaggcactcgcgactcggtacgccgaccgtgggctgactgtgctc
ggcgtgccgtgcaaccagttcgccgggcaggagccgggctccgccgaggagatcgccacc
ttctgctccaccacctatggtgtgaccttcccgctgctcgagaagaccgacgtcaacggt
gacgcgcgtcatccgctctacgtggagctggccacgacccccgacgccgagggggaggcc
ggcgacatcacctggaacttcgagaagttcctcatcgcgccggatcacgtcacggtgcag
cggttccggccgcgcaccgagcccgagtccgacgaggtggtcggcgcgatcgaggccgtc
ctcccgagctga

DBGET integrated database retrieval system