KEGG   Tsukamurella paurometabola: Tpau_3668Help
Entry
Tpau_3668         CDS       T01228                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tpr  Tsukamurella paurometabola
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tpr01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tpr00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3779470..3780762)
Genome map
AA seq 430 aa AA seqDB search
MSTVGQPRTAAEIQQDWDTNPRWKGITRDYTAEQVAELQGSVVEEHTLAKRGAEILWEGV
TKGDDSYINALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVP
AVVRRINNALLRADEISRVEGDTSIDNWLVPIVADGEAGFGGALNVYELQKAMIAAGAAG
THWEDQLASEKKCGHLGGKVLIPTQQHIRTLSSARLAADVANTPTVVIARTDAEAATLIT
SDVDDRDKPFVTGERTAEGFYNVKNGIEPCIARAKAYAPYADLIWMETGTPDLELAKKFA
ESVKAEFPDQLLAYNCSPSFNWKQHLDDATIAKFQNELGAMGFKFQFITLAGFHALNYSM
FDLAYGYARNQMSAYVELQEREFASEARGYTATKHQREVGAGYFDRIATTVDPESSTTAL
KGSTEEGQFH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtcggacagcccaggaccgccgccgagatccagcaggattgggataccaac
ccgcgctggaagggcatcacgcgtgactacaccgccgagcaggtcgcggagctccagggc
tccgtcgtcgaggagcacaccctcgcgaagcgtggcgcggagatcctctgggagggcgtg
accaagggcgacgacagctacatcaacgccctgggtgccctcaccggcaacatggccgtg
cagcaggtgcgcgccggcctcaaggccatctacctctccggctggcaggtcgccggcgat
gcgaacctctcgggccacacctaccccgaccagtcgctgtacccggccaactcggttccc
gccgtggtgcgtcgcatcaacaacgcgctgctgcgcgccgacgagatctcccgcgtcgag
ggtgacacctcgatcgacaactggctcgtcccgatcgtcgccgacggtgaggccggcttc
ggtggcgccctcaacgtgtacgagctgcagaaggccatgatcgccgcgggtgccgccggt
acccactgggaggatcagctcgcctcggagaagaagtgcggccacctcggtggcaaggtg
ctcatcccgacccagcagcacatccgcaccctgagctcggcccgcctggccgccgacgtc
gcgaacacccccaccgtggtcatcgcacgtaccgacgccgaggccgccaccctgatcacc
tcggacgtggacgaccgcgacaagcccttcgtcaccggtgagcgcaccgccgagggcttc
tacaacgtcaagaacggcatcgagccctgcatcgctcgcgccaaggcctacgccccgtac
gccgacctgatctggatggagaccggcacccccgatctcgagctcgccaagaagttcgcc
gagtcggtcaaggccgagttcccggaccagcttctggcctacaactgctcgccgtccttc
aactggaagcagcacctggacgacgcgaccatcgcgaagttccagaacgagctgggcgcc
atgggcttcaagttccagttcatcaccctggccggcttccacgccctcaactactcgatg
ttcgacctggcctacggctacgcccgtaaccagatgtcggcctacgtcgagctgcaggag
cgcgagttcgcttcggaggcccgtggctacaccgccaccaagcaccagcgtgaggtcggc
gccggctacttcgaccgcatcgccaccaccgtcgacccggagagctcgaccaccgcgctc
aagggttcgaccgaggagggccagttccactaa

DBGET integrated database retrieval system