KEGG   Tsukamurella paurometabola: Tpau_3801Help
Entry
Tpau_3801         CDS       T01228                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tpr  Tsukamurella paurometabola
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tpau_3801
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tpau_3801
   00650 Butanoate metabolism
    Tpau_3801
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Tpau_3801
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tpau_3801
   00622 Xylene degradation
    Tpau_3801
   00621 Dioxin degradation
    Tpau_3801
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Tpau_3801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3922691..3923599)
Genome map
AA seq 302 aa AA seqDB search
MTEKVTAAIVGPGNIGTDLLAKLRRSEHVDVKYMVGVDPGSDGLKRAAEWGLRTSADGVD
WLLAQSEPPQIVFEATSAKAHRAHAPRYKEAGIVAVDLTPAAVGPLACPVVNLESQLDVP
NINMITCGGQATIPIVHAVSRVTPVSYAEIVASVSSRSAGPGTRANIDEFTETTARAIEE
VGGAAKGKAIIIINPVEPPMIMRDTVFCAIDPEADRDAITASIEKMVADVQVYVPGYTLK
APPQYDEARPGWEGKARVAVFLEVAGNGDYLPTYAGNLDIMTAAAARAGELLAQRILAGV
NA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaaagtgaccgcggcgatcgtcggcccggggaacataggcacggacctactg
gccaagctgcggcgcagcgagcacgtggacgtgaaatacatggtgggcgtcgacccggga
tcggatggtctgaagcgggccgccgaatggggtctgcgtacctcggcggatggcgtggat
tggctgctggcgcagtcggaacccccgcagatcgtgttcgaggcgacctcggcgaaggcg
caccgcgcccacgcaccccggtacaaggaggcgggcatcgtggccgtcgacctgacgccg
gcggcggtcggaccactggcctgtccggtagtgaacctcgagtcgcagctggatgtgccg
aacatcaacatgatcacctgcggtgggcaagccacgatcccgatcgtgcatgcggtcagc
cgggtcacgccggtgagctatgcggagatcgtcgcatcggtgtcgtcccgttccgcaggg
cccgggacgcgcgccaacatcgatgagttcaccgagaccaccgcgcgtgcgatcgaggag
gtcggcggcgccgccaagggtaaggcgatcatcatcatcaatccggtcgagccgccgatg
atcatgcgcgacaccgtgttctgtgccattgatcccgaggccgaccgcgacgcgatcacc
gcctcgatcgagaagatggtggccgacgtccaggtgtacgtcccgggttacacgctcaag
gccccgccgcagtacgacgaggcccgcccgggctgggagggtaaggcgcgcgtcgcggtc
ttcctggaggtcgcgggcaacggcgactacttgcccacctacgcgggcaacctcgacatc
atgaccgccgccgccgcgcgcgccggcgagctgctcgcgcagcgcatcctggcaggagtg
aacgcatga

DBGET integrated database retrieval system