KEGG   Tsukamurella paurometabola: Tpau_3801Help
Entry
Tpau_3801         CDS       T01228                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tpr  Tsukamurella paurometabola
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tpr00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tpr00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:tpr00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:tpr00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:tpr00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3922691..3923599)
Genome map
AA seq 302 aa AA seqDB search
MTEKVTAAIVGPGNIGTDLLAKLRRSEHVDVKYMVGVDPGSDGLKRAAEWGLRTSADGVD
WLLAQSEPPQIVFEATSAKAHRAHAPRYKEAGIVAVDLTPAAVGPLACPVVNLESQLDVP
NINMITCGGQATIPIVHAVSRVTPVSYAEIVASVSSRSAGPGTRANIDEFTETTARAIEE
VGGAAKGKAIIIINPVEPPMIMRDTVFCAIDPEADRDAITASIEKMVADVQVYVPGYTLK
APPQYDEARPGWEGKARVAVFLEVAGNGDYLPTYAGNLDIMTAAAARAGELLAQRILAGV
NA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaaagtgaccgcggcgatcgtcggcccggggaacataggcacggacctactg
gccaagctgcggcgcagcgagcacgtggacgtgaaatacatggtgggcgtcgacccggga
tcggatggtctgaagcgggccgccgaatggggtctgcgtacctcggcggatggcgtggat
tggctgctggcgcagtcggaacccccgcagatcgtgttcgaggcgacctcggcgaaggcg
caccgcgcccacgcaccccggtacaaggaggcgggcatcgtggccgtcgacctgacgccg
gcggcggtcggaccactggcctgtccggtagtgaacctcgagtcgcagctggatgtgccg
aacatcaacatgatcacctgcggtgggcaagccacgatcccgatcgtgcatgcggtcagc
cgggtcacgccggtgagctatgcggagatcgtcgcatcggtgtcgtcccgttccgcaggg
cccgggacgcgcgccaacatcgatgagttcaccgagaccaccgcgcgtgcgatcgaggag
gtcggcggcgccgccaagggtaaggcgatcatcatcatcaatccggtcgagccgccgatg
atcatgcgcgacaccgtgttctgtgccattgatcccgaggccgaccgcgacgcgatcacc
gcctcgatcgagaagatggtggccgacgtccaggtgtacgtcccgggttacacgctcaag
gccccgccgcagtacgacgaggcccgcccgggctgggagggtaaggcgcgcgtcgcggtc
ttcctggaggtcgcgggcaacggcgactacttgcccacctacgcgggcaacctcgacatc
atgaccgccgccgccgcgcgcgccggcgagctgctcgcgcagcgcatcctggcaggagtg
aacgcatga

DBGET integrated database retrieval system