KEGG   Tsukamurella paurometabola: Tpau_3826Help
Entry
Tpau_3826         CDS       T01228                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00071  Fatty acid degradation
tpr00280  Valine, leucine and isoleucine degradation
tpr00281  Geraniol degradation
tpr00310  Lysine degradation
tpr00360  Phenylalanine metabolism
tpr00362  Benzoate degradation
tpr00380  Tryptophan metabolism
tpr00410  beta-Alanine metabolism
tpr00627  Aminobenzoate degradation
tpr00640  Propanoate metabolism
tpr00650  Butanoate metabolism
tpr00903  Limonene and pinene degradation
tpr00930  Caprolactam degradation
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01130  Biosynthesis of antibiotics
tpr01212  Fatty acid metabolism
Module
tpr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tpau_3826
   00650 Butanoate metabolism
    Tpau_3826
  Lipid metabolism
   00071 Fatty acid degradation
    Tpau_3826
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tpau_3826
   00310 Lysine degradation
    Tpau_3826
   00360 Phenylalanine metabolism
    Tpau_3826
   00380 Tryptophan metabolism
    Tpau_3826
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tpau_3826
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tpau_3826
   00281 Geraniol degradation
    Tpau_3826
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tpau_3826
   00627 Aminobenzoate degradation
    Tpau_3826
   00930 Caprolactam degradation
    Tpau_3826
Enzymes [BR:tpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tpau_3826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADG80401
UniProt: D5UYU8
Position
3950256..3951038
Genome map
AA seq 260 aa AA seqDB search
MSTLIRSTVAAPGIHVITVDAPPVNALTVQGWFDLAAALTEAGADPDCHVVVLRAEGRGF
NAGVDIKEIDASEGYGALIGANHGCAAAFSAVYDCAVPVIVAVNGFCLGGGIGLVGNADV
VVASDDATFGLPEVDRGALGAATHLARLVPQHLMRTLYFTAGTVTAQQLHHFGSVYRVVP
RAQLDETALEVARSIAAKDTRVIRKAKEAINGIDPVNVHTSYRFEQGFTFELNLAGFSDE
HRQEFVATGRTVGEAREEKA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtccacactgatccggagcaccgtcgcggcccccgggatccatgtgatcacggtggac
gcgccgccggtcaacgctctcaccgtgcagggctggttcgacctcgcggccgccctcacc
gaggccggggccgaccccgattgccacgtcgtggtgcttcgtgcggagggccgcggattc
aacgccggtgtcgatatcaaggagatcgacgcctcggaggggtacggggcgctgatcggg
gccaaccacggctgcgcagcagccttctccgccgtgtacgactgcgccgtgcccgtgatc
gtcgcggtcaacggattctgcctgggtggcggtatcggtctggtaggcaacgccgacgtg
gtcgtcgcctccgatgacgccaccttcggacttcccgaggtcgatcgcggcgcactcggt
gccgcaacacatctggcacgactggtaccgcagcacctgatgcgcacgctgtacttcaca
gcgggcacggtgaccgcgcagcagctgcaccatttcggctcggtgtaccgcgtggtcccc
cgcgcccagctcgacgagaccgcgctcgaggtggcccggtcgatcgccgccaaggacacc
agggttatccgcaaggccaaggaggccatcaatggaatcgatccggtgaacgtgcacacc
agctatcgcttcgaacagggcttcaccttcgagctgaatctcgccgggttctccgacgag
catcgccaggagttcgtcgcgaccggtcggaccgtcggcgaggcgagggaggagaaggca
tga

DBGET integrated database retrieval system