KEGG   Tsukamurella paurometabola: Tpau_3846Help
Entry
Tpau_3846         CDS       T01228                                 

Definition
fumarate reductase/succinate dehydrogenase flavoprotein domain-containing protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
tpr  Tsukamurella paurometabola
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Tpau_3846
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     Tpau_3846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3969783..3971243
Genome map
AA seq 486 aa AA seqDB search
MSTRRRPIAAESVTDWNLEADVVIAGYGIAGVCAAIEAARAGADVLVLERAGGWGGAAAA
SGGWIYLGGGTALQRSLGFDDSAENMETFMTAALGPGVDTAKIHDYAHGSIDHYDWLVDC
GVVFKEEFWGEPGWEVPHDEGLGYSGGENSAPFNTIAAPAPRGHVPQMADKQTGVRGAGY
MLMKPLVDTAEDLGVRAEYDVRAHTLVSDAAGRVCGLAARRFGEDLTIRARRGVVLATGS
FAYNAEMVATYAPRLIGRPAAAVEEHDGAGILMAQAAGAGVAHMDATEVAFFGDPQMMAR
GILINGRGQRFIAEDTYGGRIGQAALIQQDNTVFLVMDMQSHEEALATETSTPYFRQPPT
WAAETVDELESDMGLPAGTLAGTVATYNRYAAAGTDPLLHKKKQWVRPLTGPVAAWDMRG
FTAGFTLGGLHTDVESRVLHVDGEPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFFGRRA
GISAAT
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagcactcgccgacgcccgatcgccgccgaatccgtgaccgactggaacctggaagcc
gatgtggtgatcgccggatacggcatcgccggggtctgcgccgcgatcgaggccgcacgg
gcaggggccgatgtcctcgttctcgagcgggccggcggttggggcggagcggccgccgcc
tcgggtggctggatctacttgggcggcggcaccgcgttgcaacgctcgctgggcttcgac
gacagcgcggagaatatggagaccttcatgacagcggcgctcgggcccggcgtcgacacc
gccaagatccacgactacgcccacggcagcatcgaccactacgactggctggttgactgc
ggcgtggtcttcaaagaggagttctggggcgagcccggctgggaggtcccgcacgacgaa
ggcctcgggtactccggcggcgagaattccgcaccgttcaacacgatcgccgctcctgcg
ccccgcgggcatgtgccgcagatggcggacaagcagaccggcgtccgcggcgccggatac
atgttgatgaaaccactggtggacaccgcggaagacctcggtgtgcgcgccgagtacgac
gtgcgagcgcacacgctggtcagcgacgccgcggggcgagtgtgcgggctcgccgcccgg
cggttcggcgaggatctcaccattcgggcccgacggggcgtcgtgctcgcgaccgggagc
ttcgcctacaacgcggagatggtcgcgacctatgcaccacggctgatcgggcggcccgcc
gcggcggtcgaggaacacgacggtgcgggaatcctcatggcacaggccgcgggcgccggg
gtggcgcacatggacgcgaccgaggtggcattcttcggcgatccgcagatgatggcgcgc
ggaatcctgatcaacgggcgcggccagcggttcatcgcggaggacacgtacggcggccgg
atcgggcaggcggcactgatccagcaggacaacacggttttcctggtgatggacatgcag
tcgcacgaggaggcgttggcgaccgagacgtccaccccgtatttccggcagccacctacc
tgggcggcggagacggtcgacgaactggaatccgatatgggcctgcccgccggcactctc
gcaggcaccgtcgccacctacaaccggtatgccgcggccggtaccgacccgctgctgcac
aagaagaagcagtgggtgcgcccgctcaccgggcccgtggccgcgtgggacatgcgtgga
ttcaccgccggattcaccctcggcgggttgcacaccgatgtcgaatcgcgggtgctgcac
gtggacggcgagccgattcccgggttgttcgccgcgggcaggtgcacctccggggtgtgt
gcgggcggctatgccagcggcacgagcctcggtgacggaagtttcttcggccgacgcgca
ggcatctccgccgcaacctaa

DBGET integrated database retrieval system