KEGG   Tsukamurella paurometabola: Tpau_4008Help
Entry
Tpau_4008         CDS       T01228                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tpr  Tsukamurella paurometabola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tpau_4008
DNA repair and recombination proteins [BR:tpr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Tpau_4008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4136675..4137322)
Genome map
AA seq 215 aa AA seqDB search
MYEGPVQELIDELAKLPGVGPRGAQRIAFHLLGAQPSEIDRLTHALTRVRDDVRYCEVCG
NVSADVRCRICSDSRRDASKICVVEEAKDVQAVERTREYRGLYHVLGGALNPIKAIGPDK
LRIRELLVRLGAAVDGVEVDEVIIATDPNTEGEATAAFLVRMLKDFPGLTVTRPAAGLPM
GAELEFADELTLGRAMSGRRSLAEPPRVLEETPPS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggccccgttcaagagctgatcgacgagctcgccaagctcccgggggtggga
ccgcgcggcgcccagcgcatcgccttccacctcctgggagcacagcccagcgagatcgac
cggctcacccatgccctcacccgcgtacgcgacgacgtgcggtactgcgaggtgtgcggc
aacgtctccgccgacgtgcgctgtcggatctgctcggattcgcggcgcgacgcctccaag
atctgcgtggtcgaggaggccaaggacgtccaggctgtggaacgcacccgcgagtaccgc
gggctctatcacgtgctcggcggcgccctgaacccgatcaaggccatcggccccgacaaa
ctgcggatccgcgagctgctggtgcggctcggtgccgcggtcgacggggtggaggtcgac
gaggtgatcatcgccaccgacccgaacaccgagggcgaggccactgccgccttcctggtg
cggatgctcaaggacttccccggcctcacggtgacccggcccgcagccggactgcccatg
ggcgccgagctggagttcgccgacgagctcaccctgggccgcgccatgagcggccggcgc
tcgctcgccgaaccgccccgcgtgctcgaagagacgccgccgagctga

DBGET integrated database retrieval system