KEGG   Tsukamurella paurometabola: Tpau_4183Help
Entry
Tpau_4183         CDS       T01228                                 

Definition
3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
tpr  Tsukamurella paurometabola
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpau_4183
   01212 Fatty acid metabolism
    Tpau_4183
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tpau_4183
   00650 Butanoate metabolism
    Tpau_4183
  Lipid metabolism
   00071 Fatty acid degradation
    Tpau_4183
   01040 Biosynthesis of unsaturated fatty acids
    Tpau_4183
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tpau_4183
   00310 Lysine degradation
    Tpau_4183
   00380 Tryptophan metabolism
    Tpau_4183
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tpau_4183
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tpau_4183
   00281 Geraniol degradation
    Tpau_4183
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Tpau_4183
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Tpau_4183
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tpau_4183
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Tpau_4183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4307172..4309361
Genome map
AA seq 729 aa AA seqDB search
MAENMIRWDQDADGIVTLTMDDPTSSANTMNDLYRESMGATIDRLEAEKDAITGVVLTSA
KKTFFAGGNLNLIRQSTKEQAQQVFDNVENLKKDLRRLETLGKPVVAAINGAALGGGLEI
ALATHHRIAADARGSQIGLPEVTLGLLPGGGGVTRTVRLLGLQGALMGVLLQGPRLKPAK
AKEVGLVHEVVGTVEELIPAAKAWIKANPEGGVQPWDVKGFRIPGGSPNSPAIAANLPAF
PANLRKQLKGAPMPAPRAIMAAAVEGALVDFDTASVIEGRYFTSLATGQVSKNMIKAFFF
DLQHINGGGSRPDGYEKYQAKKVGVIGAGMMGAAIAYVSAKAGIEVVLKDIDIEAAKKGK
AYSEKLEEKALAKGRTTAEKSAELLARITPTVDAADFAGVDLVIEAAFESVEVKNKVFQE
IEDIVEPDAILGSNTSTLPITILAEGVKRSEDFIGIHFFSPVDKMPLVEIIKGEKTSDAV
LAKVIDYTLQIKKTPIVVNDSRGFFTSRVIGTFVNEAIAAVGEGVNPVLIEQAGQQAGYP
AAPLQLMDELTLTLPQKIRKETRAAAEAAGKPLPPHGSDAVVDAMIDNGRTGRKDGAGFY
DYVDGKRTGLWPGLKDLFPAGKDIPLQDMIDRMLFIESIETVRCFDEGVLESVADANIGS
IFGIGYPAWTGGVMQFINGYEGTEGTAAAGLQGPKAFVARANELATKYGEQFTPPASLVA
KAESGETYE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacatgatccgctgggaccaggacgccgacggcatcgtcaccctgacgatg
gacgatcccaccagctccgcgaacaccatgaacgacctgtaccgggagtcgatgggtgcc
accatcgatcgcctggaggccgagaaggacgccatcaccggcgtcgtcctgacgtcggcg
aagaagaccttcttcgccggtggcaatctcaatctgatccgccagtccaccaaggagcag
gcgcagcaggtcttcgacaacgtcgagaacctgaagaaggacctgcgccgcctcgagacc
ctgggcaagcccgtcgtggctgccatcaacggcgccgctctgggcggtggcctggagatc
gcgctcgccacgcaccaccgcatcgcggccgacgcgcgcggttcgcagatcggcctgccc
gaggtcaccctgggcctgctccccggtggtggcggcgtgacccgcaccgtgcggctcctc
ggcctgcagggcgcactcatgggtgtcctgctccagggcccgcgtctcaagccggccaag
gcaaaggaggtggggctggtccacgaggtcgtcggcaccgtcgaggaactcatccccgcc
gccaaggcgtggatcaaggccaatcccgagggcggcgtgcaaccgtgggacgtcaagggc
tttcgtatccccggcggttccccgaactcgccggcgatcgccgcgaacctgcccgccttc
ccggccaaccttcgtaagcagctcaaaggcgcaccgatgcccgcgccgcgcgcgatcatg
gctgccgcggtcgagggtgcgctggtggacttcgataccgccagcgtgatcgaggggcgc
tacttcacctcgttggccaccggtcaggtgtcgaagaacatgatcaaggcgttcttcttc
gatctgcagcacatcaacggtggcggtagccgtcccgatgggtacgagaagtaccaggcc
aagaaggtcggcgtgatcggcgccggcatgatgggcgcggccatcgcgtacgtctcggcg
aaggccggtatcgaggtggtgctcaaggacatcgacatcgaggccgcgaagaagggcaag
gcatactccgagaagctggaggagaaggcgctggccaagggccgcaccaccgccgagaag
tcggccgagctcctggcccggatcacgcccacggtggacgccgccgatttcgcgggtgtc
gatctcgtcatcgaggccgcgttcgagtccgtcgaggtcaagaacaaggtcttccaggag
atcgaggacatcgtcgaacccgacgccatcctgggctcgaacacctcgaccctgccgatc
accatcctcgccgagggcgtcaagcgctccgaggacttcatcggcatccacttcttctcc
cccgtggacaagatgcccctggtcgagatcatcaagggcgagaagacctccgacgccgtc
ctggccaaggtgatcgactacaccctgcagatcaagaagaccccgatcgtggtcaacgac
tcgcgcggcttcttcacctcccgtgtgatcggcaccttcgtcaacgaggcgatcgccgcg
gtgggcgagggagtgaaccccgtgctgatcgagcaggcgggccagcaggccggctacccg
gccgcgccgctgcagctgatggacgagctcacgctcaccctgccccagaagatccgcaag
gagacccgcgctgccgccgaggccgccggtaagccactgcccccgcacggcagcgacgcg
gtggtggacgcgatgatcgacaacggccgcaccggccgcaaggacggcgccggcttctac
gactacgtggacggtaagcgcaccggcttgtggccgggcctgaaggatctgttcccggcg
ggcaaggacattccgctgcaggacatgatcgaccggatgctgttcatcgagtcgatcgag
accgtgcgctgcttcgacgagggcgtactggagtccgtcgcggacgccaacatcggctcc
atcttcggcatcggttaccccgcgtggaccggtggcgtgatgcagttcatcaacggctac
gagggaaccgaggggacggcagccgcgggtctgcagggcccgaaggccttcgtcgctcgc
gcgaacgagctggccacgaagtacggcgagcagttcaccccgccggcctcgctggtcgcc
aaggcggaatccggcgagacctacgagtag

DBGET integrated database retrieval system