KEGG   Tsukamurella paurometabola: Tpau_4183Help
Entry
Tpau_4183         CDS       T01228                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
tpr  Tsukamurella paurometabola
Pathway
tpr00071  Fatty acid degradation
tpr00280  Valine, leucine and isoleucine degradation
tpr00281  Geraniol degradation
tpr00310  Lysine degradation
tpr00362  Benzoate degradation
tpr00380  Tryptophan metabolism
tpr00410  beta-Alanine metabolism
tpr00640  Propanoate metabolism
tpr00650  Butanoate metabolism
tpr00903  Limonene and pinene degradation
tpr00930  Caprolactam degradation
tpr01040  Biosynthesis of unsaturated fatty acids
tpr01100  Metabolic pathways
tpr01110  Biosynthesis of secondary metabolites
tpr01120  Microbial metabolism in diverse environments
tpr01130  Biosynthesis of antibiotics
tpr01200  Carbon metabolism
tpr01212  Fatty acid metabolism
Module
tpr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tpau_4183
   00650 Butanoate metabolism
    Tpau_4183
  Lipid metabolism
   00071 Fatty acid degradation
    Tpau_4183
   01040 Biosynthesis of unsaturated fatty acids
    Tpau_4183
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tpau_4183
   00310 Lysine degradation
    Tpau_4183
   00380 Tryptophan metabolism
    Tpau_4183
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tpau_4183
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tpau_4183
   00281 Geraniol degradation
    Tpau_4183
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tpau_4183
   00930 Caprolactam degradation
    Tpau_4183
Enzymes [BR:tpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Tpau_4183
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tpau_4183
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Tpau_4183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 NAD_binding_8 F420_oxidored 2-Hacid_dh_C AlaDh_PNT_C NAD_Gly3P_dh_N DAO GIDA adh_short_C2 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ADG80752
UniProt: D5UP43
Position
4307172..4309361
Genome map
AA seq 729 aa AA seqDB search
MAENMIRWDQDADGIVTLTMDDPTSSANTMNDLYRESMGATIDRLEAEKDAITGVVLTSA
KKTFFAGGNLNLIRQSTKEQAQQVFDNVENLKKDLRRLETLGKPVVAAINGAALGGGLEI
ALATHHRIAADARGSQIGLPEVTLGLLPGGGGVTRTVRLLGLQGALMGVLLQGPRLKPAK
AKEVGLVHEVVGTVEELIPAAKAWIKANPEGGVQPWDVKGFRIPGGSPNSPAIAANLPAF
PANLRKQLKGAPMPAPRAIMAAAVEGALVDFDTASVIEGRYFTSLATGQVSKNMIKAFFF
DLQHINGGGSRPDGYEKYQAKKVGVIGAGMMGAAIAYVSAKAGIEVVLKDIDIEAAKKGK
AYSEKLEEKALAKGRTTAEKSAELLARITPTVDAADFAGVDLVIEAAFESVEVKNKVFQE
IEDIVEPDAILGSNTSTLPITILAEGVKRSEDFIGIHFFSPVDKMPLVEIIKGEKTSDAV
LAKVIDYTLQIKKTPIVVNDSRGFFTSRVIGTFVNEAIAAVGEGVNPVLIEQAGQQAGYP
AAPLQLMDELTLTLPQKIRKETRAAAEAAGKPLPPHGSDAVVDAMIDNGRTGRKDGAGFY
DYVDGKRTGLWPGLKDLFPAGKDIPLQDMIDRMLFIESIETVRCFDEGVLESVADANIGS
IFGIGYPAWTGGVMQFINGYEGTEGTAAAGLQGPKAFVARANELATKYGEQFTPPASLVA
KAESGETYE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacatgatccgctgggaccaggacgccgacggcatcgtcaccctgacgatg
gacgatcccaccagctccgcgaacaccatgaacgacctgtaccgggagtcgatgggtgcc
accatcgatcgcctggaggccgagaaggacgccatcaccggcgtcgtcctgacgtcggcg
aagaagaccttcttcgccggtggcaatctcaatctgatccgccagtccaccaaggagcag
gcgcagcaggtcttcgacaacgtcgagaacctgaagaaggacctgcgccgcctcgagacc
ctgggcaagcccgtcgtggctgccatcaacggcgccgctctgggcggtggcctggagatc
gcgctcgccacgcaccaccgcatcgcggccgacgcgcgcggttcgcagatcggcctgccc
gaggtcaccctgggcctgctccccggtggtggcggcgtgacccgcaccgtgcggctcctc
ggcctgcagggcgcactcatgggtgtcctgctccagggcccgcgtctcaagccggccaag
gcaaaggaggtggggctggtccacgaggtcgtcggcaccgtcgaggaactcatccccgcc
gccaaggcgtggatcaaggccaatcccgagggcggcgtgcaaccgtgggacgtcaagggc
tttcgtatccccggcggttccccgaactcgccggcgatcgccgcgaacctgcccgccttc
ccggccaaccttcgtaagcagctcaaaggcgcaccgatgcccgcgccgcgcgcgatcatg
gctgccgcggtcgagggtgcgctggtggacttcgataccgccagcgtgatcgaggggcgc
tacttcacctcgttggccaccggtcaggtgtcgaagaacatgatcaaggcgttcttcttc
gatctgcagcacatcaacggtggcggtagccgtcccgatgggtacgagaagtaccaggcc
aagaaggtcggcgtgatcggcgccggcatgatgggcgcggccatcgcgtacgtctcggcg
aaggccggtatcgaggtggtgctcaaggacatcgacatcgaggccgcgaagaagggcaag
gcatactccgagaagctggaggagaaggcgctggccaagggccgcaccaccgccgagaag
tcggccgagctcctggcccggatcacgcccacggtggacgccgccgatttcgcgggtgtc
gatctcgtcatcgaggccgcgttcgagtccgtcgaggtcaagaacaaggtcttccaggag
atcgaggacatcgtcgaacccgacgccatcctgggctcgaacacctcgaccctgccgatc
accatcctcgccgagggcgtcaagcgctccgaggacttcatcggcatccacttcttctcc
cccgtggacaagatgcccctggtcgagatcatcaagggcgagaagacctccgacgccgtc
ctggccaaggtgatcgactacaccctgcagatcaagaagaccccgatcgtggtcaacgac
tcgcgcggcttcttcacctcccgtgtgatcggcaccttcgtcaacgaggcgatcgccgcg
gtgggcgagggagtgaaccccgtgctgatcgagcaggcgggccagcaggccggctacccg
gccgcgccgctgcagctgatggacgagctcacgctcaccctgccccagaagatccgcaag
gagacccgcgctgccgccgaggccgccggtaagccactgcccccgcacggcagcgacgcg
gtggtggacgcgatgatcgacaacggccgcaccggccgcaaggacggcgccggcttctac
gactacgtggacggtaagcgcaccggcttgtggccgggcctgaaggatctgttcccggcg
ggcaaggacattccgctgcaggacatgatcgaccggatgctgttcatcgagtcgatcgag
accgtgcgctgcttcgacgagggcgtactggagtccgtcgcggacgccaacatcggctcc
atcttcggcatcggttaccccgcgtggaccggtggcgtgatgcagttcatcaacggctac
gagggaaccgaggggacggcagccgcgggtctgcagggcccgaaggccttcgtcgctcgc
gcgaacgagctggccacgaagtacggcgagcagttcaccccgccggcctcgctggtcgcc
aaggcggaatccggcgagacctacgagtag

DBGET integrated database retrieval system