KEGG   Thalassiosira pseudonana: THAPSDRAFT_12234Help
Entry
THAPSDRAFT_12234  CDS       T01078                                 

Definition
(RefSeq) predicted protein
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00061  Fatty acid biosynthesis
tps00620  Pyruvate metabolism
tps00640  Propanoate metabolism
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01130  Biosynthesis of antibiotics
tps01212  Fatty acid metabolism
Module
tps_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    THAPSDRAFT_12234
   00640 Propanoate metabolism
    THAPSDRAFT_12234
  Lipid metabolism
   00061 Fatty acid biosynthesis
    THAPSDRAFT_12234
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    THAPSDRAFT_12234
Enzymes [BR:tps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     THAPSDRAFT_12234
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     THAPSDRAFT_12234
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     THAPSDRAFT_12234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carboxyl_trans ACC_central CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp_3 ATP-grasp Dala_Dala_lig_C
Motif
Other DBs
NCBI-GeneID: 7452465
NCBI-ProteinID: XP_002287470
JGI: 12234
UniProt: B8BVD1
Position
2
AA seq 2251 aa AA seqDB search
VIEKVLIANNGVAAVKAIRSIRRWAYEVFGNERAISFVVMATPEDLRANAEYIRMGDIIV
DVPGGSNNHNYANVNLIVELARLHAVHAVWAGWGHASEKPLLPNTLAKSDPPIKFIGPAG
PPMHALGDKIGSTIIAQNAGVPCIAWNGSHVVAEYDVKTGSLPEEAFNNACVMSALEAST
AAEKIGFPIMIKASEGGGGKGIRMVDKTEDVQNAYRQVCGEVPGSPIFIMKLSSNSRHLE
VQLLADEYGDAIALNGRDCSVQRRHQKIIEEGPPVAATPDVWKQMEEAAVSLAKAVGYTN
AGTVEYLYSEPDEKFYFLELNPRLQVEHPVTEMITRVNLPAAQLQVAMGIPLYHIPEIRE
LYGKNRFEDDVSNGKTAIDFANTERVPPNGHCIAVRITAENAEAGFKPTSGGIQELNFRS
TPNVWGYFSMDSSGSIHEFADSQFGHLFANGADREQARRNMVLALKELSIRGDISTTVDY
ISKLIELEDFVENNIDTGWLDEIIKEGGIELMADAPDTSRATNGGSNNDTLAVIGATVVA
YDQCSGDEETFLELLERGQLPSLSLLNMVREVELILDGTKYKLCCTRTGNNEFHIAVSGE
TSKFVATSVRMLSDGGYLIDIGGKSQVAYQTSKADAASGMKLSVGGKSIAFSPDYDPSSL
RTDVAGKLVKKLVPNGAHVKKGSPYAEIEVMKMFMPLKVEETGIITWANNEGAALSPGDI
LAKLELENPENVTTATIFSGDLDVTGWGSCDTASTSTGSKRPHITLRRAMNRLKCGMGGY
VITPAIIDSVMHDIEDAVKDPSLPVYEIDEHLSVLSGRIDGGLYDELSNLLSDFKEKCAS
GANDSMRFPADQVKHLVAVHMGSIKDESERAAFSALSTPLVDAAEPYTKSRAVSAPGAER
VLSGFLDILREWITVERCFCDGVAYADAVDSLRKANKGNAAGVLQMCRSHALLNSTATVI
LRIIDSIAEAGKTDINAPSSTGKIASVVLGADGLEDTTPCLTDIAAMRGNEIYDILSQRS
RNVLIEESLPSIEERKKRVEQSVKSLAGGDSAAQIQDLIDDNIIGSDIIFPLLKDATDAN
AQLGALELAARKQYRTYDLKEFNPMPDQNSLKFTFHNKPHASVFSSTACITSMTDLSRAL
SSSKLSDLNRSDSSGSLQTLLKVCNSFTDIYEDAGAIQAMLKEFPQYAGTSPRCETGPAN
VLSVYILQADAGVDQNSMANKLELLLARNLESLEKADVRRVSFMIPNAESGSDNQFSLPS
VFTFRETAAFKEDHLYRDIEPEVSHHLEMLRLTKNFSVSCLGAHLSPTGQIYLYKATPKS
SALAQDKKANKSSRIFARAVSFVSDFSAGTFERLLIESFNAIDSIKTAVPVGDNHLFLNI
ASDSCAVIDPVDVEQVVGAILKRHGERASRIGLAEIEAKVVCRLADDSHPISLRLVASNP
TGFVQVLNTYVEAADGSGQKRVFKSIGGTKANLACSGDSSWEDLEVTTPYPLTRPFDAQR
KAAAKSSDTLYCYDLPALFEAAVENQWATSPGVGSQPLMVMFTTELVVRKKSGGPWTMQD
YMNGKLELVEMQRKAGKNDVGMVAWLMTLKTVEYPMGRQVVLIANDITHKAGSFGTREDV
VFKMASVFARERRVPRLYIAANSGARIGLAEGVKKVFKVAFKDVSNPESGIDFLYVNKAD
YEHLGVNQKYVIGEPTTVNGEDVFKLTDIIGAEPDLGVENLKGSGLIAGETSSAYEDIFT
LTVVLGRTVGIGAYLVRLGQRTIQKMTSSPIILTGYQALNKLMGVDVYSTNDQLGGPGIM
YSNGISHLAERDHLSAVTSAVHWLSFVPSMRGGLLPITDITGVDEVERPICFMPKAGVPY
DPRCLLAGQEDDNGNWHGGFFDRGSFTETLAGWAKSVVVGRARLGGIPMGVIATENRTAE
AIKPADPADLRACEAVIQEAGCVWFPNSAYKTAQAINDFRTEDLPLIIFANWRGFSGGQR
DMFDEVLKYGSLIVDAFVKCQQPVFVYIPPHAEIRGGAWVVLDASINESVMEMYASAEHA
RGGVLEANGAATVKYRLKDMLTTMHRLDEKLKALDAELEARVCESEREEVMDAIKEREQA
LLPIYEQISVQFCELHDTPGRMKAVGVIERAVEWKHARTYFYWRLRRKLAEYDLRKKIIE
TAQVGRGTTALSPVEASKLIKSWFLKTPGAKDALWDDDKAVLSWMAQHQDDLEMKIVRLT
RENVVQEVFQVMTAGGETAKVGTSGIVEGIS
NT seq 6753 nt NT seq  +upstreamnt  +downstreamnt
gtcattgagaaggtgctgattgccaacaatggcgtggctgctgtcaaggccattcgcagt
attcgcaggtgggcgtatgaggtgtttggaaacgagagggctatttcgtttgttgttatg
gctactccggaagatttacgcgccaacgccgaatacatccgaatgggtgacatcatcgta
gacgtccccggcggctccaacaaccacaactacgccaacgtcaacctcatcgtcgaacta
gcccgcctccatgcagtccatgccgtttgggcaggatggggacacgcgtccgagaagccc
ctcctccccaacactcttgccaagtccgacccacccatcaagttcattggacctgcgggt
cctccgatgcatgctctgggggataagattggaagtacgattatcgctcagaatgcgggt
gtgccgtgcattgcttggaatggaagtcatgtcgttgcggagtatgatgtcaagacgggg
agtttgcccgaggaggcgtttaataatgcctgtgttatgagtgctttagaggcaagtacg
gctgctgagaagattgggtttccaattatgatcaaggcttcggagggaggaggggggaag
ggtattcgtatggtggacaaaacggaggatgtacagaatgcgtataggcaagtgtgcggg
gaggtgcctgggagtcccatctttattatgaagttgtcttcgaactctcgtcacttggaa
gtacagcttttagctgatgagtatggagatgctattgcattgaatggacgtgattgctcc
gtacaacgtcgtcatcaaaagattatcgaggagggaccacccgttgctgctactcctgat
gtatggaaacagatggaagaggcagcagtatccctcgccaaggctgtgggatacaccaat
gcaggtactgtggagtatctgtactcagagcctgatgagaagttttatttcttggagttg
aacccccgattgcaggtggaacatcctgttaccgagatgatcacgagggtgaacttgccc
gcggcccagttgcaagtggcaatgggtattccattatatcacatccccgaaattcgtgag
ttgtacggaaagaatcgctttgaggatgatgtatcaaatggaaagacggctattgacttt
gccaacaccgaacgagttccacccaatggtcattgcattgccgttcgtataactgccgaa
aatgccgaggcagggtttaaaccaacaagtggagggattcaagagcttaatttcagatca
actcccaatgtttggggttacttcagcatggacagttctggatctattcatgagtttgcg
gattctcaatttgggcacttgtttgccaatggagcggatagggagcaggcacgtcgcaac
atggtgttggcactgaaggagctttcgattcgtggcgatatcagtacgacggtggattac
atttccaagttgattgaattggaagactttgtggagaacaacattgatactggttggctg
gacgagattattaaagaaggtggtattgagctaatggcagatgctcctgatacttcacgt
gcaacaaatgggggcagtaacaatgacactttggcagtgattggagcaactgtcgtggct
tacgatcaatgctctggagacgaggaaactttccttgagttgttagaaagaggtcaactt
ccgtctctttcacttttgaatatggttcgagaagtagaactcattttggacggcaccaag
tataagctctgctgtactcgtaccggcaacaacgaattccacattgcagtatcaggggaa
acgtccaagtttgtcgccacctctgtacgaatgctcagtgatggaggatacctcatcgat
attggaggcaagagtcaagtagcctaccaaaccagtaaagcagatgcagccagtggcatg
aagttgagtgttggtggcaagagtattgcattctctcctgattacgacccatcttcttta
cgaactgatgttgcaggcaagctcgtcaagaagcttgtaccaaatggtgctcacgtcaag
aaagggagtccttacgcagagattgaagtgatgaagatgtttatgccattgaaagttgag
gagactggtatcatcacttgggcaaataacgaaggagcagcattgtcgcctggagatatt
ttagctaaacttgaattggagaatcccgagaacgtcacaacagcaactatcttcagcggg
gatttggatgttactggatggggctcgtgtgatacagcctcgacttcgacaggcagcaaa
aggcctcacatcacgcttagaagggctatgaatagactcaagtgtggaatgggaggatat
gtcatcacgccagcaatcattgacagcgttatgcacgacattgaagatgctgtaaaggat
ccttctcttcctgtgtacgaaattgatgagcatttatctgttcttagtggtagaattgat
ggaggtttgtatgacgagctttcgaacttattgagtgacttcaaggagaaatgtgcctca
ggagcgaatgattcgatgagatttccagcagatcaagtcaagcatctagttgccgttcac
atgggcagcatcaaagacgagtcagaacgtgctgcattctcagcactatctaccccgcta
gttgatgctgcggaaccttacaccaaaagtcgtgccgtgtctgctcctggagccgaacgt
gtcttgtctggattccttgacattctccgcgaatggattaccgtggaacgttgcttttgc
gatggagtagcgtatgctgatgccgtggacagcctgaggaaagccaacaaaggcaatgct
gcaggtgttcttcaaatgtgtcgttcgcatgctcttctcaattctactgcaaccgtaatt
ttgagaatcattgactctatcgccgaggctggaaagacggatatcaacgctccttcatcc
acaggaaaaattgcgtccgtggtgttgggagcagatgggttggaagacacaacaccatgc
ctgactgatattgctgccatgaggggaaacgaaatatacgacattttgtctcaaaggtcc
aggaatgtgctcattgaggagtccctcccgagtattgaagagagaaagaagagagttgag
cagtcggtgaaatctcttgcaggaggagattcggcagcccagattcaagacctcatagac
gacaacattattggctctgacattatcttccctctgttgaaggatgctacagacgcaaat
gcacaactcggtgctcttgaacttgctgcgcgaaagcagtatcgcacttacgatctcaaa
gaattcaatccaatgcctgatcaaaactcactcaagttcaccttccacaacaagccgcac
gcgagtgtcttcagcagtacggcttgcattacgagtatgactgacctctcaagggcttta
agcagcagcaagctatctgatctcaatagaagcgactccagcggcagtttgcagaccttg
ttgaaagtgtgtaactccttcacagacatttacgaagacgcgggtgccatccaggcaatg
ctcaaggagtttccccaatatgccgggacttctccacgttgcgagacgggtccagccaat
gtcctctcagtgtacatattgcaagctgacgccggtgtggatcaaaacagtatggccaac
aagcttgaattgctcttggctcgcaatcttgaaagcttagagaaagcagatgttagaaga
gtgtcattcatgattcctaatgccgagagtggaagtgacaatcaattctcacttccttcc
gtcttcacgttccgagagactgctgcgttcaaggaagatcatttgtacagggacatcgag
ccggaggtttctcatcacttggaaatgcttcgcctcacaaagaacttcagtgttagttgt
cttggtgcccatttgtcacccactggccaaatctacctttacaaagcaaccccgaaatcg
tctgctttggcgcaagacaagaaagctaacaagtcctctcggatatttgcccgtgcagtc
agcttcgtcagtgatttctctgcaggaacatttgaacgccttctgatcgagtcgttcaac
gcaattgactctatcaagacagctgttccagttggagacaatcacctcttcttgaacatt
gcaagtgactcctgtgctgtcattgaccctgttgacgtagagcaggtcgttggggcaatt
ctcaagcgtcacggagagcgtgcatcacgtattggccttgctgagattgaagctaaggtt
gtgtgcagattggcagatgactcgcatcctatttcactacgattggttgccagcaatcca
actgggttcgttcaagtcttgaacacatacgtcgaggctgcggatggctcaggccagaag
cgtgtgttcaagtcgatcggaggcaccaaggctaacttggcatgcagtggtgatagctca
tgggaagacctggaagtgactacgccgtatcctctcactcgtcccttcgatgcccaaaga
aaggctgctgccaagtcctctgatactttgtattgttacgatctaccagctctgtttgaa
gcagccgttgaaaatcaatgggctacttctccgggcgttggttctcaacctttgatggtc
atgttcactactgaacttgtcgtgaggaagaaatcaggaggcccatggacgatgcaagat
tacatgaacggaaaattggagctggttgaaatgcagagaaaagctggaaagaacgacgtc
ggtatggttgcatggctcatgactctcaagacggttgaataccctatgggacgtcaagtc
gtcttgatcgccaatgacatcacccacaaagcaggaagtttcggtacacgcgaggatgtt
gtattcaagatggcctccgtgtttgcaagagaaaggcgcgtgcctagattgtatatcgca
gcaaactctggcgcaaggattggattggccgagggagtcaagaaagtctttaaagttgcg
ttcaaagatgtttccaatccggagagtggtattgacttcttgtatgttaacaaggcagac
tatgaacacctcggcgtgaatcaaaagtatgtgattggagagccaaccactgtaaatgga
gaagacgtttttaagctcaccgacattattggagctgagccagatttgggcgtggagaac
ctaaagggttctggattgattgctggcgagaccagttcagcatacgaggacatctttact
ttgacagtcgttcttggaaggactgtcggtatcggtgcctacctcgttcgccttggtcag
cgaacgatccagaaaatgacatcttctccaatcatcctgacgggttaccaagcattgaac
aagctgatgggagttgatgtctactcaacgaacgaccagcttggaggaccaggcattatg
tactccaatggtatttcacatcttgctgagagagatcatctttcggctgtaacttctgcc
gttcactggctgtcgtttgtcccttccatgcgtggaggccttctgcctattactgacatc
actggcgtcgacgaagtggaacgtccaatctgctttatgccgaaggctggagtgccatat
gatcctaggtgtcttcttgctggtcaagaggatgataacggcaattggcatggaggtttc
tttgacagagggagcttcactgagactcttgctggttgggccaaatctgtggttgtcgga
agagctcgtttaggtggtatcccaatgggtgttatcgccactgagaatcgtaccgccgag
gccatcaaacctgctgatccagccgacttgcgtgcttgtgaggctgtaatccaagaagct
ggatgtgtctggttcccaaacagtgcttacaaaactgctcaggcaatcaacgacttccgt
actgaggatcttcctctcatcatcttcgccaactggagaggtttcagtggagggcagagg
gatatgttcgatgaagttctcaagtatggttcactcattgtcgatgcctttgtgaaatgt
cagcagcccgtctttgtctacattccaccgcatgccgagattagaggcggagcttgggtc
gtccttgatgcttcgatcaatgaatctgtcatggaaatgtatgcatctgctgagcatgcc
cgcggtggtgtactcgaagccaatggtgctgcaactgtgaagtaccgattgaaggatatg
cttacaacgatgcaccgacttgacgagaaactcaaggcacttgacgctgaactcgaagca
cgcgtttgcgagtcagagcgcgaggaagttatggatgctataaaggagagggagcaagca
ttgcttccaatctacgagcagatctcagtacagttttgtgagctgcatgatactccaggc
agaatgaaggcagtgggagtaattgaacgagctgttgagtggaagcatgcaaggacatac
ttctactggcgtcttagaagaaagcttgccgaatatgacctcaggaagaagattattgag
actgctcaagttggaagaggcacgacggctctttctcctgtcgaagctagcaaacttatc
aagagctggttcctcaaaactccaggtgccaaggacgctctttgggacgacgacaaggct
gtgttgtcgtggatggcacagcaccaagatgatctcgagatgaagattgttaggctcact
agggaaaatgttgtgcaggaggtgttccaggtcatgacagctggtggcgaaacagcaaag
gtgggaacatccggtatcgtggaaggcatctca

DBGET integrated database retrieval system