KEGG   Thalassiosira pseudonana: THAPSDRAFT_1310Help
Entry
THAPSDRAFT_1310   CDS       T01078                                 

Definition
hypothetical protein
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THAPSDRAFT_1310
   00330 Arginine and proline metabolism
    THAPSDRAFT_1310
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    THAPSDRAFT_1310
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    THAPSDRAFT_1310
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    THAPSDRAFT_1310
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     THAPSDRAFT_1310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 376 aa AA seqDB search
MASKVLVVGSGVIGLRTALELIRRKTRVCLVSPQHPLHSSTCSVGAGGLWMPFHCDDERT
DGWAFETLEEIMNFANRNEEVGKSLVEVVPAISFKQKKSNVQIPAWALDTRSKALDFQHL
TVDELYEQSRYQSFRLPKKKLIAEANYSDAWLFQAPIVDSPKMLQYMLDEVQESDCLDRV
DIESGKYYATIHEMVEEAKRLGCDGMVNCTGLGSRSICNDETLVGARGVLLQYDRSSCVW
SDDAEISGTKESVIMIEEAPFGTETEPCYTIPRGPLVVVGGTYLLGDEEKNLRPQERKKV
LENARLVGIDTSKCSPSGEWVGFRPYRQTARLEVDTEFSGDVKVIHNFGYGGSGWTVYVG
AAKGAASLLSQLDSHT
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgaaggtgcttgttgttggatctggcgtgatcggccttcgcactgcacttgaa
ctcatccgaagaaagactcgtgtatgtctcgtatctccacaacatccattgcactcatca
acttgttccgttggagctggtggtctttggatgccgtttcactgcgatgacgagagaact
gatggatgggcgtttgagacgttggaagagatcatgaactttgccaatagaaatgaagaa
gttggtaaatcattggtggaagtggttccagcaatctcgttcaagcaaaagaaaagcaat
gttcagatcccagcgtgggcactagacacaagaagcaaagccctggactttcagcatttg
actgtagatgaactctacgagcaaagcaggtatcagagctttcgtttaccgaagaaaaaa
ttgattgccgaagcgaactattcagatgcatggttgtttcaagcacctatcgtagactct
ccaaagatgctgcagtacatgctggacgaggtccaagaaagtgactgcttggatcgcgtc
gacattgaatcaggaaaatactacgcaacaatacatgaaatggtagaggaggcaaagcga
ctcggttgcgatggaatggtgaattgcactgggcttggaagtagatcgatctgcaatgac
gaaacgttggtaggagcaagaggtgttcttttgcagtacgatagatcatcatgcgtatgg
agtgacgatgctgagatcagtggtacgaaggaaagcgtaatcatgattgaagaggctcct
ttcggaactgaaacggagccatgctacacgattcctcgtggccctctcgttgtggtcggt
ggaacatatctcttgggggacgaagagaagaacctccgaccgcaagaaaggaagaaggtt
cttgagaatgcacgtctggtgggcattgatacctcgaagtgtagtccatctggtgaatgg
gttggctttcgtccgtatcgacaaactgctcgtttagaagtagatacagagtttagtggc
gacgtgaaggtaattcacaactttggttatggtgggtctggctggacagtgtacgttgga
gccgcaaaaggagcagcatcgttgctctctcaattagacagtcatacttga

  All links  
No link information was found.   
DBGET integrated database retrieval system