KEGG   Thalassiosira pseudonana: THAPSDRAFT_1394Help
Entry
THAPSDRAFT_1394   CDS       T01078                                 

Gene name
ADH1
Definition
probable alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    THAPSDRAFT_1394 (ADH1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_1394 (ADH1)
  Lipid metabolism
   00071 Fatty acid degradation
    THAPSDRAFT_1394 (ADH1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    THAPSDRAFT_1394 (ADH1)
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     THAPSDRAFT_1394 (ADH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 391 aa AA seqDB search
MIGATYNTFNEPIKVSTDLPIPHPSSDGVVVKIMATGVCRSDWHGWRGHDDDVKQFLQAN
GTPFIPGHEASGVVVEVGLDVRNFRVGDRVAIPFILSCGKCRECGDKRRRPTVCEDQHQP
GFTMHGTMAEFCAITRADRNLKRLPPDVSFVEAGALGCRFTTAYRAVLQQGKLCEDGNSS
EKTVAVFGCGGLGLSCIMIAKAFDAQKIIAVDVSEHTLQLSLKLGATDVICAKRLDSKLL
QKDENVQQTILDLTDGIGADLTIDAGGFEQTCIDAVWACRRGGRMVQVGLPAKQAALPMA
RVAGREIEIVGSHGFSSVADDTGVSALDHILELVETGRLQPRKLVEREVSLAEGIEVLMN
MNTSSPRGIVMITDFGGSRQSSNTNKFDNCV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgatcggagcaacttacaacaccttcaacgagccgatcaaagtctccacagacttacca
atcccacatccatcttctgatggcgtagttgtcaaaatcatggccacgggtgtatgtcgt
tccgactggcacggatggcgaggacacgacgatgacgtgaagcagttccttcaagcgaac
ggtacaccgtttatcccggggcatgaagcttctggtgtggttgtcgaggttggattggac
gtacggaactttagagttggagatagagttgcaattccattcatattgagctgtggcaag
tgcagagagtgcggtgataaacggagacgaccgacggtgtgcgaggaccagcatcagcca
ggcttcacaatgcacggtacgatggctgagttctgtgccatcacacgtgcagatcgcaat
ctgaaaaggctgcctcccgatgtctcattcgttgaagctggagcgcttgggtgtaggttc
acgacggcatacagagccgtcctgcaacaggggaagctgtgtgaagatggaaacagtagc
gagaagactgttgcagtatttgggtgtggaggattggggttatcatgcatcatgattgca
aaagcatttgatgcacaaaagatcattgcagttgatgtttctgagcatactttgcagtta
tcattgaagttgggagcaacggatgtcatttgtgccaagaggcttgactccaagttgctg
caaaaggacgagaatgtgcaacaaacaatcttggacttgacggatggaattggcgctgac
ttgacaatagatgcaggaggattcgaacaaacttgcatagacgcagtatgggcatgtaga
cgaggaggaagaatggttcaagtcggccttccagcaaaacaggctgctttgccaatggct
agagttgctggacgagagattgagattgttggaagtcatggcttttcatcagttgctgac
gacactggtgtgtccgcattggatcatatcctggagcttgtggaaacgggacggttgcaa
ccgcgaaagcttgttgagagagaagtatcgttagccgaagggattgaagtcttgatgaac
atgaatacatcatctcctcgcgggattgtaatgatcaccgactttggtggaagtaggcaa
agcagcaacactaacaagtttgacaactgtgtttag

DBGET integrated database retrieval system