KEGG   Thalassiosira pseudonana: THAPSDRAFT_1394Help
Entry
THAPSDRAFT_1394   CDS       T01078                                 

Gene name
ADH1
Definition
(RefSeq) probable alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00010  Glycolysis / Gluconeogenesis
tps00071  Fatty acid degradation
tps00350  Tyrosine metabolism
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_1394 (ADH1)
  Lipid metabolism
   00071 Fatty acid degradation
    THAPSDRAFT_1394 (ADH1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    THAPSDRAFT_1394 (ADH1)
Enzymes [BR:tps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     THAPSDRAFT_1394 (ADH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 7449127
NCBI-ProteinID: XP_002286780
JGI: 1394
UniProt: B8BQT8
Position
1
AA seq 391 aa AA seqDB search
MIGATYNTFNEPIKVSTDLPIPHPSSDGVVVKIMATGVCRSDWHGWRGHDDDVKQFLQAN
GTPFIPGHEASGVVVEVGLDVRNFRVGDRVAIPFILSCGKCRECGDKRRRPTVCEDQHQP
GFTMHGTMAEFCAITRADRNLKRLPPDVSFVEAGALGCRFTTAYRAVLQQGKLCEDGNSS
EKTVAVFGCGGLGLSCIMIAKAFDAQKIIAVDVSEHTLQLSLKLGATDVICAKRLDSKLL
QKDENVQQTILDLTDGIGADLTIDAGGFEQTCIDAVWACRRGGRMVQVGLPAKQAALPMA
RVAGREIEIVGSHGFSSVADDTGVSALDHILELVETGRLQPRKLVEREVSLAEGIEVLMN
MNTSSPRGIVMITDFGGSRQSSNTNKFDNCV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgatcggagcaacttacaacaccttcaacgagccgatcaaagtctccacagacttacca
atcccacatccatcttctgatggcgtagttgtcaaaatcatggccacgggtgtatgtcgt
tccgactggcacggatggcgaggacacgacgatgacgtgaagcagttccttcaagcgaac
ggtacaccgtttatcccggggcatgaagcttctggtgtggttgtcgaggttggattggac
gtacggaactttagagttggagatagagttgcaattccattcatattgagctgtggcaag
tgcagagagtgcggtgataaacggagacgaccgacggtgtgcgaggaccagcatcagcca
ggcttcacaatgcacggtacgatggctgagttctgtgccatcacacgtgcagatcgcaat
ctgaaaaggctgcctcccgatgtctcattcgttgaagctggagcgcttgggtgtaggttc
acgacggcatacagagccgtcctgcaacaggggaagctgtgtgaagatggaaacagtagc
gagaagactgttgcagtatttgggtgtggaggattggggttatcatgcatcatgattgca
aaagcatttgatgcacaaaagatcattgcagttgatgtttctgagcatactttgcagtta
tcattgaagttgggagcaacggatgtcatttgtgccaagaggcttgactccaagttgctg
caaaaggacgagaatgtgcaacaaacaatcttggacttgacggatggaattggcgctgac
ttgacaatagatgcaggaggattcgaacaaacttgcatagacgcagtatgggcatgtaga
cgaggaggaagaatggttcaagtcggccttccagcaaaacaggctgctttgccaatggct
agagttgctggacgagagattgagattgttggaagtcatggcttttcatcagttgctgac
gacactggtgtgtccgcattggatcatatcctggagcttgtggaaacgggacggttgcaa
ccgcgaaagcttgttgagagagaagtatcgttagccgaagggattgaagtcttgatgaac
atgaatacatcatctcctcgcgggattgtaatgatcaccgactttggtggaagtaggcaa
agcagcaacactaacaagtttgacaactgtgtttag

DBGET integrated database retrieval system