KEGG   Thalassiosira pseudonana: THAPSDRAFT_1397Help
Entry
THAPSDRAFT_1397   CDS       T01078                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     THAPSDRAFT_1397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 558 aa AA seqDB search
MDAKEPVAGLSAASSCIRLSICLPTDASSAASNTSVITPKTTSSHAPSSKRTFRPVFTHQ
CFPNECLPGWKPTTEAERESQQIYDSWKVGSLDDEVHPSYEQCCVSSSETSNDKRVDVHV
LLAPSCHTCNVEIQITGKDIATYDSDGEPEHKKLKSNPSEGQKTNANAECVECQSGGGVM
NVEEIVQQVSLAVPPIASVHVNSTPFNDWSTESKDTTNATISTRKSKYLSQPIGHVLKRY
QRKVKGSTNNHTEEATFVITMAKGSDATVAPYHNAIQPMARWFIETADDVDVSSEDGGFW
NVLYLFQEHTLSSPDTDGGNDSGTMQQQSTRYSLAGYITLFHFHSPFRKPQPGIVVRVCQ
ALILPPYQRAGHGSEMLQIVYKYADEYAESAFSDSTGIDIVEVNVEDPAPGFIALRDLVD
YKRFASLASDIGNGNYIKNLEEHNVTDNEYYSPVSEEQLQAVSSKLKITKRQAQIVHEMF
KLAKLEERKQSLDRTSNDDDTIQSVETQYRLMVKRSIRSNRKEELGACTGGKKEQKALLE
KWFQDTLTHYRSLMGIRR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggacgccaaagagccagttgccggcctctcggccgcatcgtcgtgcattcgcctctcg
atatgcctcccaactgatgcatcctcagcagcatcaaatacatcagtcatcactcccaaa
acaacatcatcgcatgcaccgtcatcgaagaggaccttccgtccagtgtttacccaccaa
tgctttccaaatgagtgccttccaggatggaaacctacaacagaggcagagcgtgagtct
caacagatatatgactcatggaaagtaggcagtttggacgacgaagttcatccgtcgtat
gagcaatgttgcgtaagttcatcggagacgagcaatgacaagagagttgatgtgcatgtg
ttgcttgcaccttcttgccacacgtgcaatgttgagatacaaattactggaaaagatatt
gcaacttatgattcagatggcgagcctgaacacaaaaagttgaagtcaaatccaagcgag
ggacaaaaaacgaacgcaaatgccgaatgcgttgagtgccagagtggtggtggtgtcatg
aatgtcgaagagattgtacaacaagtttctctagctgtccctcccattgcttcagttcat
gtcaatagcactccgttcaatgactggtctacggaatcaaaggatacaaccaatgcaaca
atttcgacgcgtaaaagcaagtatctttcacaacccatcggccacgtcctcaaaagatat
cagcgcaaggtcaagggttcaacaaataatcatacagaagaagcaacatttgttatcacc
atggcaaaagggagtgatgcaaccgttgctccttatcacaacgctattcaacccatggcg
cgttggttcattgagactgccgacgacgttgatgtgtcaagtgaagatggtggcttttgg
aatgtcttgtatctgtttcaggagcatactttgtcgtcacctgatacagatggtggcaat
gatagtggaactatgcaacaacaaagcactcgatactcattggctggatacatcaccctc
ttccactttcactcgccttttaggaagccccagcctggaatagtcgtacgagtttgtcaa
gcactgattctacctccctaccaaagagcaggacatggttccgaaatgcttcagattgta
tacaaatatgctgacgagtatgccgagtcggcattcagtgattcgactgggattgacatc
gtcgaggtcaatgtggaagatccagctcctggttttattgcattgagagatttggttgac
tacaaacgatttgcatctctcgcatctgatatcggcaacggcaactatataaaaaacttg
gaggagcataatgtcacagacaatgagtactattcaccagtgtccgaagaacaattgcaa
gccgtgtcgtccaagctcaagattaccaaacggcaagctcaaatagtacacgagatgttc
aagttggcgaaactggaggagcggaagcaatctttagatagaacatcaaacgatgatgat
acaatccaatcagtggaaactcaataccgactaatggtcaagagatcaattcgttcaaat
cgcaaagaggagcttggtgcatgcacaggtgggaagaaagagcaaaaggcattgttggag
aagtggtttcaagatactttaactcattatcgttctttgatgggaattagaaggtaa

DBGET integrated database retrieval system