KEGG   Thalassiosira pseudonana: THAPSDRAFT_15123Help
Entry
THAPSDRAFT_15123  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
tps  Thalassiosira pseudonana
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tps00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    THAPSDRAFT_15123
Enzymes [BR:tps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     THAPSDRAFT_15123
Peptidases [BR:tps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THAPSDRAFT_15123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 341 aa AA seqDB search
GACGLINLGNTCYANSGIQCLSYLPLLRSYLLSGQFKGDLNRDNPLGTGGKLLEEFAELM
QVMWSGKYGVRAPQKFRSFLGKCRPQYSGADQQDAQELINDMIDMLHEDGNRVKKKPYVE
ALEDKFIEKTDLPRVGQEAWRRFLRRNRSAVSDLSMGQVYNSVTCPVCNHSSKNFDPFNM
LSLPFPTVAEVIFQCTVVRRATEQRLDAVDCWRCPVCKVDREGKQSMALWNLPDLLTFHL
KRFNASSRWREKISTKVDFPLTGLNMREWCDKESPLLEEETTPTGWRLGRNKEKDSSSTA
ASKGVAKSAEPLWLQFDDDLVEPLPPRNVVSETAYVLFYRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ggtgcatgcggtttgatcaatcttggcaatacatgctacgccaactctggaattcagtgc
ttgtcgtacttgccacttctccgatcgtatttgctgagtggccagttcaagggagatctg
aatagagacaatcctttgggcactggtggcaagttactggaggagtttgccgaactaatg
caggtcatgtggagtggcaaatatggagtccgtgcacctcaaaagtttcgtagctttctt
gggaaatgccgaccgcaatactctggagcggatcagcaggatgcgcaggagttgatcaac
gacatgattgatatgcttcatgaagatggtaaccgagtgaagaagaagccatacgttgaa
gcattggaagacaaattcattgaaaagacggatctccctagagttggccaagaggcgtgg
cgacgatttctacggagaaacagatcagctgtttcagatctatccatgggtcaggtctac
aacagtgtcacttgcccggtgtgcaaccactccagcaagaactttgatccattcaacatg
ctttcgttgccttttccaacagtggcagaggtcattttccaatgcactgttgtcagaaga
gcaaccgaacaacgcttggatgccgtggactgttggcgttgtccggtgtgcaaggtggat
agagaaggcaagcaaagtatggcactttggaaccttcccgatctcttgactttccacttg
aaacgatttaatgcatcttcgaggtggagggaaaagatcagcaccaaagtggatttcccg
ttgactgggctgaacatgcgagagtggtgtgataaggaatctccgttgttggaggaggaa
acaacaccgactggatggagacttggacggaacaaggagaaggactcatcgtcaactgcc
gcttccaagggagttgcaaaatctgctgaaccgctttggttgcaatttgacgatgatctt
gtggaaccattgcctccgcgaaatgtagtgtctgaaaccgcatatgtcttgttctacaga
agg

DBGET integrated database retrieval system