KEGG   Thalassiosira pseudonana: THAPSDRAFT_15123Help
Entry
THAPSDRAFT_15123  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
tps  Thalassiosira pseudonana
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:tps04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 341 aa AA seqDB search
GACGLINLGNTCYANSGIQCLSYLPLLRSYLLSGQFKGDLNRDNPLGTGGKLLEEFAELM
QVMWSGKYGVRAPQKFRSFLGKCRPQYSGADQQDAQELINDMIDMLHEDGNRVKKKPYVE
ALEDKFIEKTDLPRVGQEAWRRFLRRNRSAVSDLSMGQVYNSVTCPVCNHSSKNFDPFNM
LSLPFPTVAEVIFQCTVVRRATEQRLDAVDCWRCPVCKVDREGKQSMALWNLPDLLTFHL
KRFNASSRWREKISTKVDFPLTGLNMREWCDKESPLLEEETTPTGWRLGRNKEKDSSSTA
ASKGVAKSAEPLWLQFDDDLVEPLPPRNVVSETAYVLFYRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ggtgcatgcggtttgatcaatcttggcaatacatgctacgccaactctggaattcagtgc
ttgtcgtacttgccacttctccgatcgtatttgctgagtggccagttcaagggagatctg
aatagagacaatcctttgggcactggtggcaagttactggaggagtttgccgaactaatg
caggtcatgtggagtggcaaatatggagtccgtgcacctcaaaagtttcgtagctttctt
gggaaatgccgaccgcaatactctggagcggatcagcaggatgcgcaggagttgatcaac
gacatgattgatatgcttcatgaagatggtaaccgagtgaagaagaagccatacgttgaa
gcattggaagacaaattcattgaaaagacggatctccctagagttggccaagaggcgtgg
cgacgatttctacggagaaacagatcagctgtttcagatctatccatgggtcaggtctac
aacagtgtcacttgcccggtgtgcaaccactccagcaagaactttgatccattcaacatg
ctttcgttgccttttccaacagtggcagaggtcattttccaatgcactgttgtcagaaga
gcaaccgaacaacgcttggatgccgtggactgttggcgttgtccggtgtgcaaggtggat
agagaaggcaagcaaagtatggcactttggaaccttcccgatctcttgactttccacttg
aaacgatttaatgcatcttcgaggtggagggaaaagatcagcaccaaagtggatttcccg
ttgactgggctgaacatgcgagagtggtgtgataaggaatctccgttgttggaggaggaa
acaacaccgactggatggagacttggacggaacaaggagaaggactcatcgtcaactgcc
gcttccaagggagttgcaaaatctgctgaaccgctttggttgcaatttgacgatgatctt
gtggaaccattgcctccgcgaaatgtagtgtctgaaaccgcatatgtcttgttctacaga
agg

DBGET integrated database retrieval system