KEGG   Thalassiosira pseudonana: THAPSDRAFT_15161Help
Entry
THAPSDRAFT_15161  CDS       T01078                                 

Definition
histone acetyl transferase, gcn5-related
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     THAPSDRAFT_15161
Transcription machinery [BR:tps03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     THAPSDRAFT_15161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 342 aa AA seqDB search
IVINDGKRESLIRLIGLKSLFGKQLPKMPKEYIARLVFDRRHKSLALLSSDPRKKDSDDE
IIGGICYRSYPEMRFAEIAFCAVNASQQVKGYGTKLMNLLKMHAVTEGIEYFITYADNYA
IGYFKKQGFTKVVQMPKSRYQGLIKDYDGGTIMECYVHPSIDFTRVPEMVRAQREFILQR
LRYTAKSDKVVYPPLPSDFAQNLDITSRSTGNATRALAIPGVAEAGWTMPDLMASTGGVK
DADQRKDMLKKELLGLIQKVQDKQFSWCFRDPVDTNEVTDYLDVVTEPIDLRTMEKRIRK
GDHYKNKHQLYADMMKMVNNCKIYNDPDSTYYECAVSLEKFL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
attgtaatcaacgacggcaaacgtgaatcactcattcgtctcattggtctcaaatccctc
tttgggaaacagcttcccaaaatgcccaaagagtatatcgcccgtttggtctttgaccga
cgtcataaatcactggcgttgttgagcagcgatcctcgtaagaaggacagcgatgatgaa
atcatcgggggaatatgctaccgcagctatcccgagatgagatttgctgaaattgcattc
tgtgcagtgaatgcctctcagcaagtgaagggatacgggacaaagttgatgaatttgctt
aagatgcatgctgtcaccgagggcattgagtatttcatcacgtacgctgacaattatgcc
attggatacttcaagaagcagggttttaccaaggtggttcagatgcccaagagtcggtac
cagggattgatcaaggattacgacggaggtacgattatggagtgttatgtccatccgtcg
attgactttacgcgagtgccagaaatggttcgggctcaacgtgaattcatcctacagcgt
ttacgatataccgccaaatcagacaaggttgtctaccccccgttaccatccgactttgct
caaaacttggatatcacatctcgttctacgggaaatgcgacacgtgccttggccattcca
ggagtggcagaggctggatggacgatgccggatttgatggcttctacggggggagtgaag
gacgccgatcaacggaaggatatgttaaagaaggagttgctggggctgattcagaaagtg
caggataagcaattcagctggtgctttcgtgatccggtagatacaaatgaggttactgat
tatctcgatgtggtgacggagccgattgacttgcgtactatggaaaaacggattagaaaa
ggggatcattacaagaacaaacaccagttgtatgcggatatgatgaagatggtgaacaat
tgcaagatatacaatgacccggacagtacgtattatgagtgtgctgtgagcttggagaag
ttcttg

DBGET integrated database retrieval system