KEGG   Thalassiosira pseudonana: THAPSDRAFT_15819Help
Entry
THAPSDRAFT_15819  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     THAPSDRAFT_15819
Protein phosphatases and associated proteins [BR:tps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     THAPSDRAFT_15819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 228 aa AA seqDB search
YFTPDSVREAKAAASSLCKLVSNVVSGDLDSGFAVIRPPGHHAEPGLAGGYCVINNVAVA
ASYAQEQLGVKKVLIVDWDVHHGNGTQKCFFDNPNVMYFSAHRYHGGNFFPFLQQGGPSS
VGNGAGRGFNMNVGWNDKKMGDDEYLVVWEKLLMPVANEFNPDLVIVSAGFDAAHGDMGE
CDITPECFARLTRRLKTLANGKVVCALEGGYVRSVLCKCIESVLSSLL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
tactttacacctgactccgtgcgggaagccaaggctgctgcttcttctctttgcaagctc
gtatctaacgtagtttctggggaccttgatagcggtttcgcggttattcgcccccctggc
catcatgcggagcctggtttggctggtggttactgtgttatcaataacgtagctgttgct
gcttcttatgctcaagagcaacttggtgtcaagaaagttctcattgtcgactgggatgtc
caccacggtaacggaactcagaagtgtttctttgacaaccccaacgtcatgtacttttcc
gcacacagatatcacggtggtaacttcttccccttcttgcaacaaggtggaccttcaagc
gttggaaatggagctggaagaggattcaacatgaatgtcggctggaacgacaagaaaatg
ggagatgatgagtatctcgttgtgtgggagaagctactgatgcctgtggccaacgagttt
aaccctgatcttgtcattgtcagtgccggctttgatgctgctcatggcgacatgggagaa
tgcgacattactccggagtgctttgcaagattgacacgtcgcctcaagacattggctaac
ggaaaggtcgtgtgtgctttggagggtggctacgtgagaagcgtactctgtaaatgtatt
gagagtgttctatcctcattgctt

DBGET integrated database retrieval system