KEGG   Thalassiosira pseudonana: THAPSDRAFT_15858Help
Entry
THAPSDRAFT_15858  CDS       T01078                                 

Definition
(RefSeq) hypothetical protein
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_15858
   00052 Galactose metabolism
    THAPSDRAFT_15858
Enzymes [BR:tps01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     THAPSDRAFT_15858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 359 aa AA seqDB search
IRLFRISLNNVTVDLSSVGASITKILLPNYSVQSSDDTTSSRDDVVLSYATPLDQYNDQN
PIYFSAIVGRVANRIRNGRFQLPQPSNCDETNHEDSETVLETYQLEINNEPNHLHGGSGG
FSNRNWSVSVVNDTVQFTLISVDGDQGYPGGIEVTATYSLVPISNNDDRGTKSNNTRGAK
LCLTMQAKLLPGETKSSPISLAQHSYFNLTSHSSDERILKHVLTMPNCHGYTPVDDTSIP
TREVKRVDYDTAMDFRKGMTLADALVQYGDPYGFDHNYTIQREEPPSNATTQTLQLAAIL
KHPPTNRSLRVFTTAPGVQLYTANYLNGSTPSAESCKDGCNYNQWQGICLETQTYPDSI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atacgactatttcggatatcactcaacaacgtgacggtcgatctctcctccgtcggtgca
tccattaccaagatcttgcttccaaactattctgttcaatcatcagacgacaccacgtct
agtagagatgatgtggtgctgtcctatgcaactccgttagatcagtacaatgatcagaat
ccgatatacttctcggcgatcgttggaagggtagctaatcgtatcaggaatggtcgattc
caattaccgcaaccatccaactgtgacgagacgaatcatgaagacagcgagacagttctc
gagacgtatcagcttgagataaacaatgaaccaaatcatcttcatggtggctctggagga
tttagcaatcggaattggagtgtatctgttgtgaatgatactgttcaattcacattgata
agtgtcgatggcgaccagggttatcccggtggtattgaagtgactgcaacgtactctcta
gtaccaatttcaaacaacgatgatagagggacaaaatcaaacaacacacgtggtgcaaag
ctatgtctaacaatgcaagcgaaactactccccggagaaacgaaatcatcaccgatatct
ctggcacaacattcatacttcaatttgacatcgcattcatcggatgagcggatattgaag
catgtgctgacgatgccgaactgtcacgggtacactccggtagacgatacttctattcct
actagagaagtaaaacgagtagattacgatacagcaatggactttcggaaagggatgacg
ttggcggatgcattggttcaatacggggatccctacggattcgatcacaactatacaatt
caaagagaagaaccaccatccaatgcaacaacacagacactacaactcgcggcaatacta
aagcatcctcctacaaaccgttcgctccgcgtgtttacaacagcgccaggagtacaactt
tacacagcaaactacttgaatggatcaactccctctgcagaatcgtgtaaagatgggtgc
aactacaatcaatggcaagggatttgtctagagactcagacgtatcctgattcaata

DBGET integrated database retrieval system