KEGG   Thalassiosira pseudonana: THAPSDRAFT_15858Help
Entry
THAPSDRAFT_15858  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tps00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tps00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 359 aa AA seqDB search
IRLFRISLNNVTVDLSSVGASITKILLPNYSVQSSDDTTSSRDDVVLSYATPLDQYNDQN
PIYFSAIVGRVANRIRNGRFQLPQPSNCDETNHEDSETVLETYQLEINNEPNHLHGGSGG
FSNRNWSVSVVNDTVQFTLISVDGDQGYPGGIEVTATYSLVPISNNDDRGTKSNNTRGAK
LCLTMQAKLLPGETKSSPISLAQHSYFNLTSHSSDERILKHVLTMPNCHGYTPVDDTSIP
TREVKRVDYDTAMDFRKGMTLADALVQYGDPYGFDHNYTIQREEPPSNATTQTLQLAAIL
KHPPTNRSLRVFTTAPGVQLYTANYLNGSTPSAESCKDGCNYNQWQGICLETQTYPDSI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atacgactatttcggatatcactcaacaacgtgacggtcgatctctcctccgtcggtgca
tccattaccaagatcttgcttccaaactattctgttcaatcatcagacgacaccacgtct
agtagagatgatgtggtgctgtcctatgcaactccgttagatcagtacaatgatcagaat
ccgatatacttctcggcgatcgttggaagggtagctaatcgtatcaggaatggtcgattc
caattaccgcaaccatccaactgtgacgagacgaatcatgaagacagcgagacagttctc
gagacgtatcagcttgagataaacaatgaaccaaatcatcttcatggtggctctggagga
tttagcaatcggaattggagtgtatctgttgtgaatgatactgttcaattcacattgata
agtgtcgatggcgaccagggttatcccggtggtattgaagtgactgcaacgtactctcta
gtaccaatttcaaacaacgatgatagagggacaaaatcaaacaacacacgtggtgcaaag
ctatgtctaacaatgcaagcgaaactactccccggagaaacgaaatcatcaccgatatct
ctggcacaacattcatacttcaatttgacatcgcattcatcggatgagcggatattgaag
catgtgctgacgatgccgaactgtcacgggtacactccggtagacgatacttctattcct
actagagaagtaaaacgagtagattacgatacagcaatggactttcggaaagggatgacg
ttggcggatgcattggttcaatacggggatccctacggattcgatcacaactatacaatt
caaagagaagaaccaccatccaatgcaacaacacagacactacaactcgcggcaatacta
aagcatcctcctacaaaccgttcgctccgcgtgtttacaacagcgccaggagtacaactt
tacacagcaaactacttgaatggatcaactccctctgcagaatcgtgtaaagatgggtgc
aactacaatcaatggcaagggatttgtctagagactcagacgtatcctgattcaata

DBGET integrated database retrieval system