KEGG   Thalassiosira pseudonana: THAPSDRAFT_16952Help
Entry
THAPSDRAFT_16952  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tps  Thalassiosira pseudonana
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THAPSDRAFT_16952
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     THAPSDRAFT_16952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 200 aa AA seqDB search
VHGTWDDHDYGGNDRGSELKDREARRDAYLNFLGVLKENKRYQRRGVYSSVEFGDDVHSM
QYDSTNTQGRSNNKVKVIFLDTRWHREKHCIPSVGSNLYIPFGAIISCVTRWLTAGLNLP
SWRVCPTDSQVLGDEQWIWLEKQLKDSTASMHIVVSSIQILTTNPVVESLGHFPKERERF
LRLLNDVNGLVLLSGDVHHA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtacatggtacgtgggacgaccacgactatggtggtaatgatagaggaagtgagttgaaa
gatagagaggcgagaagagatgcatatttgaattttctcggtgtattgaaggagaataag
cggtatcaacgacgaggagtgtattcatcagtagagtttggagatgatgtacattccatg
caatacgacagtacaaatactcaaggcagaagcaacaataaagtcaaagtcatctttctc
gataccagatggcatcgtgaaaagcattgcatcccgagtgttggttcaaacctctacata
ccattcggagctatcatttcttgtgtaactcgatggctcactgctggattgaacctacca
tcttggagagtatgtcctaccgacagtcaagtattgggagacgagcaatggatatggtta
gaaaaacaactgaaagatagcacggcatcaatgcatatcgttgtgagttcgatccaaatc
ttgacgacaaatcctgttgtcgagtcgttggggcactttccaaaggagagagaacgattt
ttgagactgctgaatgatgtgaacgggttggtattactgagtggggatgttcaccatgca

DBGET integrated database retrieval system