KEGG   Thalassiosira pseudonana: THAPSDRAFT_18091Help
Entry
THAPSDRAFT_18091  CDS       T01078                                 

Definition
phospholipase (EC:3.1.1.5)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    THAPSDRAFT_18091
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     THAPSDRAFT_18091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 208 aa AA seqDB search
SATIVICHGLGDTAQGWEDVARNFASKLPYAKFILPTAPTRKITMNMGMSMPGWYDIVGL
DKRSNENCPGIDESQTRILDILKSENDAGIHYNRMVLAGFSQGAALSLYTGMQLPAEAGP
LAGIVAMSGYLPHASGFNITPGLESTPIFHAHGAVDPLVQITAAKDSQEMVKEKGATSYK
LEIYEGLAHSANPKEIGDVMAFLEEVLP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
agtgctaccattgtcatctgtcacggtctaggcgatactgcgcagggatgggaggatgtg
gctcggaactttgcatcgaagcttccctacgcaaagttcatccttccaactgcaccaact
cgaaagattaccatgaacatggggatgagcatgccaggatggtatgatattgtcggattg
gataaacgcagcaatgaaaactgtcctggcattgatgaatcacaaacacgtattttggat
attctaaagtcggagaacgatgccggcattcattacaatcgtatggttctagcaggtttc
tcgcagggcgctgctctcagtttgtacactggtatgcaactgcctgccgaggcgggacct
cttgccggaattgtggctatgagtggatacttgccacatgcaagtggattcaacattact
cctggtcttgaaagtactcccatctttcatgctcatggagcagttgatccattggtgcaa
atcacggcagcaaaagatagtcaagaaatggtgaaagagaagggagcaacatcgtacaaa
cttgagatttacgaaggattggcacactcagcaaaccccaaagagattggagatgtgatg
gctttcttggaagaagtcttgcca

  All links  
No link information was found.   
DBGET integrated database retrieval system