KEGG   Thalassiosira pseudonana: THAPSDRAFT_18091Help
Entry
THAPSDRAFT_18091  CDS       T01078                                 

Definition
phospholipase (EC:3.1.1.5)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tps00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 208 aa AA seqDB search
SATIVICHGLGDTAQGWEDVARNFASKLPYAKFILPTAPTRKITMNMGMSMPGWYDIVGL
DKRSNENCPGIDESQTRILDILKSENDAGIHYNRMVLAGFSQGAALSLYTGMQLPAEAGP
LAGIVAMSGYLPHASGFNITPGLESTPIFHAHGAVDPLVQITAAKDSQEMVKEKGATSYK
LEIYEGLAHSANPKEIGDVMAFLEEVLP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
agtgctaccattgtcatctgtcacggtctaggcgatactgcgcagggatgggaggatgtg
gctcggaactttgcatcgaagcttccctacgcaaagttcatccttccaactgcaccaact
cgaaagattaccatgaacatggggatgagcatgccaggatggtatgatattgtcggattg
gataaacgcagcaatgaaaactgtcctggcattgatgaatcacaaacacgtattttggat
attctaaagtcggagaacgatgccggcattcattacaatcgtatggttctagcaggtttc
tcgcagggcgctgctctcagtttgtacactggtatgcaactgcctgccgaggcgggacct
cttgccggaattgtggctatgagtggatacttgccacatgcaagtggattcaacattact
cctggtcttgaaagtactcccatctttcatgctcatggagcagttgatccattggtgcaa
atcacggcagcaaaagatagtcaagaaatggtgaaagagaagggagcaacatcgtacaaa
cttgagatttacgaaggattggcacactcagcaaaccccaaagagattggagatgtgatg
gctttcttggaagaagtcttgcca

DBGET integrated database retrieval system