KEGG   Thalassiosira pseudonana: THAPSDRAFT_21108Help
Entry
THAPSDRAFT_21108  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     THAPSDRAFT_21108
Protein kinases [BR:tps01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   THAPSDRAFT_21108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 691 aa AA seqDB search
MPTISEYLNKAIVNKPTDGSDMLTLEDARRELGKLRKVARRVCDALDSVDAPPKHQQTNG
VKFKSPSVLKEHGKTHRKALQMDQSFKAYKKVPFAKSDEQRALIKGAVQKNALFANSTDL
ELEEYIDVFVERNFKQNDTVIQQGDEGDTFYVVQSGSLDIFINVGEGSKKTEQHVGVPYG
AGGAFGELALIYGSPRAATIRASADCVLWEISRTAFKGLQLQMEQRAYEVKITQLKKVKV
GDKLFGEVLEPNELESMALATHYQQFKKGHAIVTEGEKGDVFYIITRGEVDIFKKSAGDV
KIASLSVNSFFGEKALLNSDTRQATVVAATDVECLALERDEFVSMLGDLQSLLEGKRQTI
ADKAITPTFHLQQPDSAVELTLNQVQIRRVLGEGAFGKVNLGKSVVDGRLFALKAQSKHH
IVKLKQEEKVLTEYKIMRKLDHTFIVKCYQAFQDSQYIYFLMSLLPGGELMDLLDTKQKL
PEQWTRFYAATVVMAFSCMHQQKIAYRDLKPENLVLDEEGYCFVVDFGLAKVCSKGKTWT
MCGTPDYLAPEILRGNGHDWGVDYWALGILLYELTNGDAPFYADDPAVTAKKIIKGEYVD
PPHFSEELNDIISQFLCGQSKRLGRTMGGERKIMTHPWFAGFNWQALMDREMKVPYKPKV
GKLEKLGRKDDGKWDAPVSNWSPVFEELFDV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccatcagcgagtatctcaacaaggcaatagtcaacaaaccaactgatggttct
gacatgctcactctcgaagacgcacgtcgtgagcttggcaaactacgcaaggtcgctcgt
cgtgtctgcgatgcacttgattcagtggacgctcctcccaaacatcagcagaccaatgga
gtcaagttcaagtcaccttccgtgctcaaggagcatggtaaaactcaccgaaaggcactg
cagatggatcaatccttcaaggcgtataagaaggtgcccttcgcaaagtcggatgagcaa
cgtgcgttgatcaaaggtgctgttcagaagaatgccctctttgccaacagtactgatttg
gagttggaggaatatatcgatgtgtttgtagagcgtaatttcaagcagaatgatacggtg
attcaacaaggagacgagggtgatacgttttacgtggtacaatctggctcattggatatc
ttcatcaacgtaggcgagggatcaaagaagacagaacaacatgtaggcgtcccttacgga
gccggtggtgcgtttggtgaattggcactcatctacggtagtcctcgagccgctactatc
cgtgcctccgctgactgtgtgctatgggagatttcacgtacggcattcaagggattgcaa
cttcagatggaacagcgtgcttacgaggtgaagattactcagttgaagaaggtaaaggtt
ggcgataagttgtttggggaggttttggaaccgaatgaattggagagtatggctttggct
acgcattatcaacagtttaagaagggacatgcgattgtgacggagggggagaagggggat
gtgttttacattatcactaggggagaagtggatatcttcaagaagagtgcgggagatgta
aagattgctagtctgtcagtgaactcattctttggagagaaagccttgctcaattcggat
acgaggcaagctacggttgtggctgccactgatgtggagtgtctagcgttagaacgtgat
gagtttgtttctatgcttggtgatttgcaatctctcctcgagggtaagaggcagactatt
gctgataaggcaatcactcctactttccatcttcaacaaccagatagtgcggtggagttg
acgttgaatcaagtacaaatcagacgagtgctgggagaaggagcatttgggaaggtgaac
ctcggaaagagcgtcgtggacgggagattgtttgcgttgaaggcacagtctaagcatcac
attgttaaactgaaacaggaagagaaggttcttacggagtacaaaataatgaggaagttg
gatcataccttcatcgtcaagtgctaccaagcattccaggacagtcagtacatctacttc
ctaatgtctttgcttccaggaggagaattgatggatctgttggataccaaacagaagctt
ccagaacaatggactaggttttacgctgctaccgtggtcatggctttctcgtgcatgcat
caacaaaagattgcctaccgtgatcttaagcctgagaatttggtattggatgaagaaggt
tactgttttgttgtggactttggtcttgcaaaggtctgttcaaaaggtaaaacgtggacg
atgtgcggcactccagattatcttgcaccagagatccttcgcggtaacggccacgattgg
ggagttgactactgggcattgggtatcctgctatacgagttgacgaatggagatgctcct
ttctacgcggacgatcctgcagtgacggcaaagaagatcatcaagggagaatacgttgat
ccaccgcacttctccgaggaattaaatgatattatttcacaattcttatgcggacagtcg
aaacgattgggaagaacaatgggaggggaacgcaagatcatgacacatccttggtttgct
ggttttaattggcaggcactgatggatcgggaaatgaaagtgccttacaagccaaaggtt
ggcaagctagaaaaactgggacggaaagatgatggaaagtgggatgcccccgtgtcgaat
tggagtcctgtctttgaagagctctttgacgtttga

DBGET integrated database retrieval system