KEGG   Thalassiosira pseudonana: THAPSDRAFT_21109Help
Entry
THAPSDRAFT_21109  CDS       T01078                                 

Definition
sphingosine kinase (EC:2.7.1.-)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tps  Thalassiosira pseudonana
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    THAPSDRAFT_21109
Enzymes [BR:tps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     THAPSDRAFT_21109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 532 aa AA seqDB search
MTKLNDGRWPIAAASRLRVRIHNTTQASKQPPSSTHQYGRLFYNGVEGTIELIPCISAND
DDDVGAHPEVYDDSNAYIENESSYQSYLSKIKDANRTVLDSFHPHDVIGSHLSLEYNMHN
PNTFHGMESYACAKLLVYSYPKSSNTKKKGGECIGKREARHKTYVADPRCCENFSDVRSI
VQAIRSLASLEHNLPIRNANIASSNNNKPVKYLVILNPFSGGGGESSKTGARHIYETMLK
PMLEQAGVEHDALVTRRGAIIAMGGDGILFEIMQGVHSRLDEKELMQKLKFGIVGCGTSN
GLAKSLLHWSGEKYGPLESIFQICKGNTSPLDIASYQLANTTKTYTSFLTFSWGLIADCD
LDSECLRWLGPIRSDIWAVYRGILCRKKYRARFSYLPPNTKSTVPKIEEYLPKEWVTIED
DFIVFWVCNVSHASYNMYNCPMAKMNDGLFHILIVRASCSRLQLLLMLLKLETGYHIGCK
ELEVIDCTAYRLEPLTHNSHNDLDGELIEAGPIQAHVLPGGAHFFSGEVGSD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaactcaacgacggccgctggccaatagccgccgcctctcgcctgcgagtacga
atccacaatacaacccaagcatctaaacaacctccttcatcaacacatcaatacggcagg
ctcttttacaacggagtagaaggaaccatcgagctcatcccctgcatcagtgccaacgat
gacgatgacgtcggtgcacatccagaggtatacgacgatagcaatgcctacattgaaaat
gaatcatcctatcaatcatacctctccaaaattaaagatgcaaaccgaactgtacttgat
tcattccatccacacgatgttatcggatctcatctttcactagagtacaacatgcacaat
ccaaatacctttcacggaatggagagctacgcgtgtgccaagctgcttgtgtattcgtat
cccaaatcatcaaacacgaagaagaagggaggtgaatgcattggtaagagggaggcacgt
cataagacttacgttgctgatccacgttgttgtgaaaacttttcggatgtcagatcaatt
gttcaggcgatacgcagtctggcgtctcttgagcacaatctaccaatacgaaatgcaaac
atcgccagcagcaataacaacaaaccggtcaaatatctagtgatactaaatcccttcagt
ggaggaggtggcgaatcctccaaaacgggagcacggcacatctacgaaacaatgttgaag
ccaatgttggaacaagctggcgtcgagcatgatgccttggtgacacggcggggtgcaatt
atcgcaatgggaggagatggaattctatttgagattatgcagggtgttcattctcgtttg
gatgagaaggagttaatgcagaagttaaagtttggtattgtggggtgtgggacttctaat
gggttggcgaagagtttgttgcattggagtggagaaaaatacggtccactggagtccatc
tttcagatatgcaaagggaacacatcccctctcgacattgcttcctaccagctagccaac
acaacaaaaacctacacatccttccttaccttctcatggggtctcattgccgattgtgat
ttagactcagaatgtctgcggtggttgggaccaatacgatcggacatttgggcagtgtat
cgtggtatcttgtgcaggaagaagtatcgtgctcggttctcgtatttgcctccgaatacg
aaatccactgtgccaaagattgaagagtacttgccgaaggagtgggttacgattgaggat
gactttatcgtgttttgggtttgcaatgtgagccatgcgtcgtataatatgtacaactgt
ccaatggcaaagatgaatgatgggttgtttcatattctgattgtgagagcatcctgttct
aggctacaactacttctaatgcttctcaagctcgagaccggatatcatattggctgcaaa
gagttggaagtcattgactgtacagcttacagactcgaaccactgactcataacagtcac
aatgaccttgacggcgaattgatcgaagctggtcctatccaggctcatgtcttgccaggt
ggtgctcacttcttttcaggggaagttggtagtgattag

DBGET integrated database retrieval system