KEGG   Thalassiosira pseudonana: THAPSDRAFT_21364Help
Entry
THAPSDRAFT_21364  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     THAPSDRAFT_21364
Peptidases [BR:tps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THAPSDRAFT_21364
Transcription machinery [BR:tps03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     THAPSDRAFT_21364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 1576 aa AA seqDB search
MPPMHPPRCSSWAPAVSNISADGGNGTDKREIEPSPVLDSTALCSALTQDASRCRHLEEC
MFPRYLTLDCNQLDQFCLSRSGGALVRRNGKNAGRVYIESLHLKAFMKDAETLNSEMNSR
ERPPKRDESTKHSQSPSMKRKEAGSPTKRKKSNGANSYKDGAGGGLASSHCQVLPSSTIH
SADGSEGPDLLKSGVKKKSKKNANTVSPADDKFNGLLASEIKLAYLRKAMKLHDRLALLD
NLIVASGDLPSKEDGEMRQLECLSKPLPGHVQPVSTGDKVGSYFVAEGSKKVDNAQTPVS
TVAPADVPDSSTGSKPIDHTTTVPSPMNVDKVTSSATISDSPHASLIPNATAKDVSSPFE
TFEAPPASPVAGGKVVNEKKPNISTYHSYDYIVREGKEASMAANLLLESFRRNRRQHWAS
KKGGDSAKCVWCPSGNCSGPSGDALIQCLECDLVGCGPKFLDDEGSSNQHIMLHFLISGH
KFGVTCGAMGELFCMGCGDLTYHECFDQERERLFLEHNYPSLCWDETPILRGFDASSFVV
TPENGFVWRGLLATYPSPVSTKFVHASRSVAKRLAMFHGYVGERTVEWGPKSLELTTYQH
QHKNNQLVVPTPVGIYNMGNTCFMSSVLQCLLNCAPLEKLFLLDLAHPSQCCELLRLGGS
QSSCLTCELDKAFLEYYGSAVGIDALDALSETGSSVSSLTGTTVNSIEFGSTCGKKSGHP
IIPTYLLAEVWKNVGMKHLAGQNQHDAQEFFHAFLDCLASHEKSYQKLVLKTKQSLYQAQ
IQRPSENDHRKSSGDGTSDATIGKGTISIGACLEHFTHPETLADLVYCPSCNSKTTTTKQ
HDFASLPKVLCLHLKRFDAGAHRKITEHVAFPAFGLDMGKHLPQWCEKIPDANPNDGEDI
SSPQVLYDLISTVNHNGSLHQGHYVANVKKGDHWYHSNDEFVCNAGEGNGEKEVLAAEGA
YLLFYFVVRLANTSTPTMAESQGNGEHNAASNEGSNSNTIGDTTGLRRRRGRRESEGDDN
QPQRRESSTRRQSNTTAASPNTDRQHYNNNNRSDYGNYMPPRPPLTIGGGHFQSAAVGVG
NCGNGATLTSNATTATTGLGSSTQLTPYKTPTKESAIGLIAATPSSVTTAGETVESTVFS
SPQSVARRNNQLAEMSLRRQYQLLQSQIILLLGSASIGLVLFLLFALPFAAVASLAIMAA
SMAALVPVASSALQTRYQIEMEHPFGFLRYLPDSLRRMLLETSLHEFMTDTTAYMENRYL
LLYFVPGLTPDQLMAYINRLPARHRNALLQPGLGSLMPSVMGRLMRLDNNHNGGGSNVGS
LPAIDEGVRGDMSTSSQLTMDRDDTDSNREDSEMEVTLMEAITSLRQTLVRCSGNDDATT
IHDDVSVTLHAGNLFSSPLPGPELLGDSRRADSSPLVRGNGQNANTEHENVQGDDNTAQI
TGEGEDNESTTAPNQPLRGVVVEMPQSTNTDEEQRELQREYDLEGRVLSEAASTAVSNYS
SQATAAVIEGSVEAVEVASSWVIRIGSFTGLLAGGGGIALATIGNVGGSSSLVQARRSGS
WALALLMWYETVRGLQ
NT seq 4731 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgatgcacccaccaaggtgttcctcatgggcgcctgcggtcagcaatatatca
gccgacggcggcaacggcacagacaagcgtgaaatcgagccaagtccagtgctcgattcc
acagcactctgttccgccctcacacaagacgcctcccgatgtcgccacttggaagaatgc
atgtttccacgctacttaactttggattgcaatcaattggatcaattttgcttgagccgt
tcaggtggtgctctcgtgagaaggaatggcaagaatgcagggcgggtgtacatcgagagt
cttcatctcaaggccttcatgaaggatgccgagacgctgaacagtgaaatgaacagtagg
gaacggccaccgaagagagacgaatctacaaaacattcacagtctccatcgatgaagcga
aaggaagcaggcagtcctacgaaacgaaaaaagtcaaatggtgccaatagttacaaagat
ggagctggaggtggactggcttcttcacactgtcaagtgctaccgtcgtcaacgatacac
tctgctgacgggtcggagggacctgatttgctcaagagcggtgtcaagaagaagtcgaag
aagaacgccaatactgtgtctccagcggatgacaagttcaatggattgcttgcatcagag
ataaagttggcgtatttgcgcaaggcaatgaagcttcatgatcgtcttgcactattggac
aatctcattgtggcatcgggagatttgccgtcaaaagaggatggggaaatgcgtcagttg
gagtgtttgagtaagccattgccaggtcacgtccaaccggtttcaactggagataaagtt
gggagttattttgttgctgagggtagcaagaaggttgacaatgctcaaactccagtgtca
acagtggctcctgcggatgtgccggattcgtcgacagggagtaaacctattgatcataca
acaactgtgcctagtccgatgaacgtcgacaaagttacgagcagtgcaaccatatcggat
tcgccgcatgcttcgcttattccaaacgcaacagcgaaagatgtcagctcgccttttgag
acattcgaagctcctcctgcaagtcctgtagcgggagggaaggttgtgaatgaaaagaag
ccgaatatatccacatatcatagctacgactatattgtgagagaagggaaagaagcttca
atggctgcaaatctgcttctcgagtcgtttcgacgaaacagacgacagcactgggcgagc
aagaagggcggggacagtgctaagtgtgtgtggtgtccatctggaaattgttccggtcct
tcgggcgatgctttaattcaatgcttggaatgtgatttggttggatgtggcccaaaattt
cttgacgatgaagggtctagcaatcaacatataatgctacacttcttgatatctggtcac
aagtttggggtgacttgtggtgcaatgggagagctcttttgcatgggatgtggagatctg
acgtatcacgagtgctttgaccaagaacgtgaacgtctgttccttgaacacaactatccc
agtctttgctgggatgaaacacctattctacgtggatttgatgcatcatcgtttgttgta
actcccgagaatggctttgtttggcggggattgctggcgacttatcccagtcctgtatcg
acaaagtttgtgcatgcatctagatcagttgcaaaaagacttgctatgttccatggatat
gttggtgaaagaacggtagaatggggtccaaaatcgttggagttgacgacgtatcaacat
caacacaaaaataatcaactagtggtaccgacgccagtggggatctacaatatgggcaac
acttgcttcatgtcttcggtgcttcagtgtctgctcaactgtgcccctctggagaagttg
tttcttcttgatttggcgcacccatcccagtgctgcgagcttttgcgtttgggtggtagt
cagtcatcgtgcttgacgtgtgagttggacaaagctttcttggaatactacggcagtgct
gtgggtatcgatgcacttgatgcactgtcagaaactggttcctctgtgtcgtctttgact
gggacgaccgtcaattcaatagaattcggctcaacgtgtggaaagaagagtgggcaccca
atcattccaacgtatttgttggccgaagtttggaagaatgttggcatgaaacaccttgcg
gggcagaatcaacacgatgcgcaagagttcttccatgccttccttgactgcttggcgagc
catgaaaagtcttatcaaaagttggttctgaagacgaaacaaagtttgtatcaagctcaa
atacagcggccttcggagaatgatcacagaaaatcctctggagatggtacatctgacgcg
acaattggaaagggaacaattagcattggcgcctgtttggagcattttacacatccagag
actttagccgacttggtgtactgtccgtcatgcaatagtaaaacgacaacgacgaagcaa
catgattttgcatcactgccaaaggtgctctgcttgcacttgaaacggttcgatgctggt
gctcacaggaagataacggagcacgtcgcttttcctgcctttggcctggacatgggcaag
catttgcctcaatggtgcgagaagattcctgatgctaatcccaacgacggagaagatata
tccagtccacaagtattgtacgatctgatcagtacagtcaaccacaatggaagtcttcat
caaggacactacgtagcaaatgtgaagaaaggagaccattggtatcactcaaacgacgaa
tttgtatgcaatgccggggaagggaatggagagaaggaagtgttggctgcagagggcgct
tacctgctgttctatttcgttgttcgtctcgcgaacacatcgacaccgacgatggccgaa
tctcagggcaacggcgagcacaacgccgctagcaatgaagggtcaaactccaatacaatt
ggagatacgacgggtctaagacggcggcggggacgaagagagagcgaaggcgatgataat
cagcctcagcggcgtgaatcttcaacgcgtaggcaatcgaatacaactgctgcgtctccc
aataccgatagacaacattataacaacaacaacagatccgactatggaaattatatgcct
ccacgacccccactcaccatcggaggcggtcactttcaatctgcagccgttggagtcggt
aactgtggcaacggtgcaactctcacgtcaaatgcaacaacggcaacgacgggacttggc
tcctccactcaattaacaccttacaaaacaccaacgaaagaatcagcgatagggttaatc
gcagcaactccatcatctgtcactacggcaggtgaaacagtggagagtacagtcttctcg
tcgccgcagagtgttgcacgtcgtaacaaccagctggctgagatgagtttgagacgacag
tatcaactgctgcaatcacaaataattctgttgttggggagtgcgtctattggactcgtg
ttattcttgctatttgcacttccgttcgctgcagtggctagtcttgcaatcatggcagca
tctatggcagctctcgtgcccgtggcatcctctgcacttcaaacgcggtatcaaattgag
atggaacatccgtttggcttcttgcggtatcttcccgactcgctacgaagaatgctatta
gagacatcactgcatgagttcatgacggatacaactgcctacatggagaatcgctatttg
ttgctttacttcgttccgggcttgacacctgatcagttgatggcttatatcaaccgactg
cctgcgaggcacagaaatgcattgctgcagcctggattggggagcttgatgccttcagtt
atgggtcgtttgatgaggttggacaacaatcacaatggagggggatcaaacgttgggtcg
ttaccagctatagacgaaggggtgaggggagacatgtcaacatcgtcacagcttacaatg
gatagggatgatactgacagcaatagagaagattcagagatggaggtgactttaatggag
gcaattacttctctccggcagaccttggttcggtgctctggaaatgacgatgctacaaca
attcatgacgatgtttcggtgacgttgcatgcagggaatctgttctcaagtccattgcct
ggacctgagttgcttggggattcccgtcgtgctgacagctccccactcgtgcgagggaat
ggtcagaatgcgaacactgaacatgaaaacgtccaaggcgatgataacacggcacagatt
actggggagggagaagacaatgaatcaacaacagcacccaatcaaccgcttagaggtgtt
gtggttgagatgccgcaatctacgaatacagatgaagagcaacgagagctgcagagggaa
tacgatctggagggcagagtactatcggaggcagcgtctacggctgtttcaaactattct
tcacaagctacggcagcagtcatagaagggagtgtagaagcagtggaggttgcgtcgtcg
tgggtcattcgcattggttcgttcactgggctgcttgctggaggaggaggcattgcattg
gcaacaataggtaacgtgggaggctcgtcttctttggtacaagctcggcggtcgggttct
tgggcgctggcattgcttatgtggtacgaaaccgtgcgagggcttcagtag

DBGET integrated database retrieval system