KEGG   Thalassiosira pseudonana: THAPSDRAFT_21460Help
Entry
THAPSDRAFT_21460  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
tps  Thalassiosira pseudonana
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 748 aa AA seqDB search
MARRKHQQRQAHRRRKQCAALPSSCPNAGNHRHKQQQQQHVNTGDNRSQPSTQLAIVTLP
SSKMMRRRPSTSSNKPLSVTTAPLICASSCYTPLPLPLAVYRPASLFAMILIASLLPKNA
FSLRWLALSSCCFSGGADAGAANGSGRFGVARMGRLFGRAEVVNAGQISVWLALAGVSER
VQSSSYNGDNEECTTMWNAVVEVLERNTPTINTIEYSSFPSSTILESIPRGGSDSDSFTQ
QRQYAGLVNLGNTCYLNSQLQCAYHVPYLRKLVLDARDESVEVEVEVEIEVDVQVQDDGS
VVSEGVAEGDGVPVGEETGDSTIGVKGDDAAIVGVEVTPDDVVHEENQDVTTLNAEKRER
SEAEDTGATAMDDANAQGASSAETTTTKQIIRKTELRTETRPISNALRALQHTFVSLTPR
NGQSASSGTTQALCRSLGINPFIQQDGQEFWKLFVPELNYDKMTQLYSGYFDDYVREILP
ESDNDSNCEEKKDEEGDHVGKPRERVRTEQFLDLSIPVAEGMGGSVESTLREMFTQPEIL
KLSEGNGWRPSKGADKVDAYKGSSLKRDGLPSVLQLHLKRFKYDWETGETSKINDRCSFP
LKLDLSEISEPGKANENEANNDVVYDLQSIVIHRGEYGSGHYYSYVRPDIRSNEWYRFDD
QIVTKVEFNDVVADAYGGRVRRKRSRSLDESKSGSSTKQQRGLLRRIFSFGGRLKNAGDG
AFGYGGITSSAYMLQYVRRSDIPTLYLE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgccgtaaacatcagcagagacaggcgcacagacggaggaaacagtgtgctgcg
ctacctagttcatgtcccaatgctggcaaccaccgccacaaacagcagcagcagcagcac
gtgaacacgggagacaacagaagccaacccagtacacagctcgccattgtaactctccct
agttccaaaatgatgcgtcgtcgtccctcgacatcctccaacaaaccactctccgtaacg
acagcgccactcatttgtgcctcgtcctgctacacacccctcccactgccactggcagtc
taccgccccgcttctctttttgccatgatactaattgcatccttgcttcctaagaatgcg
ttttcgctacggtggttggctttgagcagttgttgcttcagtggtggtgctgatgctggt
gctgccaatggcagtgggagatttggtgtggctcgaatgggtagattgtttggacgtgct
gaagtagtgaatgcagggcagatttcggtttggctggctctggcaggggtttcagagaga
gttcagtcgtcatcttacaatggtgacaacgaagaatgcactacaatgtggaatgcggtt
gttgaagtattggagaggaacacacccacaatcaacacaatcgaatactcttccttccca
tcctcgacaatacttgaatccatcccacgaggtggaagtgattctgattcattcactcaa
caacgacaatatgcaggactagtcaacttgggcaacacgtgttatctcaattcacaactt
caatgtgcttatcatgtgccatatttgaggaagttggtattagatgcaagggatgagagt
gtagaggttgaggtagaagttgagattgaggttgatgtccaagttcaggacgatggaagt
gttgttagtgagggtgttgcggaaggtgatggcgtgcctgttggagaggagacgggtgac
agtacgattggcgtgaaaggagacgatgctgcaattgttggtgtggaagttactcccgat
gatgttgtgcacgaagagaatcaagatgtgacaacactcaatgctgaaaagcgggagaga
agtgaggcagaagatactggagcaacagcaatggatgatgctaatgcacaaggcgcttcg
tccgctgagacaacaacaaccaaacaaattattcgcaaaacagaactcagaactgaaaca
cgtccgatctctaatgctctacgggcgctccaacacacctttgtgtcactcacgccccgg
aatggtcaatcggcttcttctggaactacccaagctttgtgtcgttcgttggggatcaac
cccttcatacagcaagatggacaagaattctggaaactattcgttcctgagttgaattac
gataagatgactcaattgtacagtgggtactttgacgactatgtaagggagattcttcca
gagagtgataatgatagtaattgcgaagagaagaaggatgaggaaggagatcatgttgga
aagccacgtgaacgagtgaggacagagcagtttttggacttatcgataccagtggcggaa
ggaatgggtggttccgttgaatcaacactgagagagatgttcactcaaccagagattctt
aaactatcagagggcaacggttggagaccatccaaaggtgctgacaaggtggacgcctac
aaaggctcttcattgaagcgtgatggcctgccatcagtacttcagcttcacttgaaacga
ttcaaatatgattgggagacgggcgaaacgagcaagattaatgatcgatgtagctttcca
ttgaaattggatctctcggaaatatctgagcccggcaaggcaaacgaaaacgaagcgaat
aacgatgtcgtttatgacttgcaatctatcgttattcatagaggagagtacggtagtgga
cactactactcttatgttagaccagatatccgatcaaatgaatggtatcgatttgacgat
caaattgttacaaaagtagaattcaacgacgtcgttgccgatgcatacggcgggagagta
agaagaaaacggtctcgtagtttggacgaaagcaaatctggtagcagtaccaaacaacaa
agggggctgcttcggcgtatcttctcctttggtggacggctgaagaatgccggagatgga
gcgtttggttatgggggtataacaagcagtgcttacatgttacaatacgtgagacgttcc
gatatccctactttgtatctggagtga

DBGET integrated database retrieval system