KEGG   Thalassiosira pseudonana: THAPSDRAFT_21475Help
Entry
THAPSDRAFT_21475  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tps  Thalassiosira pseudonana
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    THAPSDRAFT_21475
Translation factors [BR:tps03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    THAPSDRAFT_21475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 265 aa AA seqDB search
MADTWDDSDDDWDKSDDELDKRLGLAKIDDEKDAGPVFNDEEEDLTLQDKAADEKANQAL
LKTKGSALAKKKAAEKSQKEELEIARKAMEMEAEMEANMTPEERRQLAREREEADATAMT
NDLFGAVDALSKGTSAVPGGVMMSGDKVVMKDLKDHLRHAKKVGECIQGHGKITLCSAFL
TEVIQQCKDVLDDDAITEIIKSCNVIKNEKVQAAKRVKKGQAQKSKKADKQAAKKAMEIH
EDVFGESNQYDEYDEMGGAYEDDFF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacctgggacgacagcgacgacgactgggacaaaagcgatgacgaactggat
aagcgtctcggtcttgcaaaaatcgatgacgagaaggacgccggtcctgtgtttaacgac
gaggaagaggatttgaccttgcaggataaagcggccgatgagaaagctaaccaggctttg
ctcaagaccaagggatccgctttggctaagaagaaggccgccgagaagtcccaaaaagaa
gaattggagatcgcaaggaaggcaatggaaatggaggcagagatggaagccaacatgaca
ccggaggaacgtaggcagcttgcacgagagagggaagaagccgatgccactgccatgacc
aatgatttgtttggagctgtagacgctttgagcaaaggcaccagtgctgtacccggaggc
gtcatgatgagcggagacaaagtggtgatgaaagatttgaaggatcacttgaggcacgct
aagaaggtgggggagtgtattcagggacacggcaaaatcacactctgttcggcatttcta
acggaggtcattcaacaatgcaaagatgtccttgacgacgatgccattactgagattatc
aaatcgtgcaacgttatcaagaatgagaaggttcaggctgcaaaacgtgtgaagaaggga
caggcacaaaaatcaaagaaagctgacaagcaagcagcaaagaaggcgatggagattcat
gaggatgtgtttggagagagtaatcagtatgacgaatacgatgaaatgggcggtgcttat
gaggacgacttcttctaa

DBGET integrated database retrieval system