KEGG   Thalassiosira pseudonana: THAPSDRAFT_21475Help
Entry
THAPSDRAFT_21475  CDS       T01078                                 

Definition
(RefSeq) predicted protein
  KO
K03245  translation initiation factor 3 subunit J
Organism
tps  Thalassiosira pseudonana
Pathway
tps03013  RNA transport
Brite
KEGG Orthology (KO) [BR:tps00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    THAPSDRAFT_21475
Ribosome biogenesis [BR:tps03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    THAPSDRAFT_21475
Translation factors [BR:tps03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    THAPSDRAFT_21475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit
Motif
Other DBs
NCBI-GeneID: 7452332
NCBI-ProteinID: XP_002288012
JGI: 21475
UniProt: B8BVG1
Position
2
AA seq 265 aa AA seqDB search
MADTWDDSDDDWDKSDDELDKRLGLAKIDDEKDAGPVFNDEEEDLTLQDKAADEKANQAL
LKTKGSALAKKKAAEKSQKEELEIARKAMEMEAEMEANMTPEERRQLAREREEADATAMT
NDLFGAVDALSKGTSAVPGGVMMSGDKVVMKDLKDHLRHAKKVGECIQGHGKITLCSAFL
TEVIQQCKDVLDDDAITEIIKSCNVIKNEKVQAAKRVKKGQAQKSKKADKQAAKKAMEIH
EDVFGESNQYDEYDEMGGAYEDDFF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacctgggacgacagcgacgacgactgggacaaaagcgatgacgaactggat
aagcgtctcggtcttgcaaaaatcgatgacgagaaggacgccggtcctgtgtttaacgac
gaggaagaggatttgaccttgcaggataaagcggccgatgagaaagctaaccaggctttg
ctcaagaccaagggatccgctttggctaagaagaaggccgccgagaagtcccaaaaagaa
gaattggagatcgcaaggaaggcaatggaaatggaggcagagatggaagccaacatgaca
ccggaggaacgtaggcagcttgcacgagagagggaagaagccgatgccactgccatgacc
aatgatttgtttggagctgtagacgctttgagcaaaggcaccagtgctgtacccggaggc
gtcatgatgagcggagacaaagtggtgatgaaagatttgaaggatcacttgaggcacgct
aagaaggtgggggagtgtattcagggacacggcaaaatcacactctgttcggcatttcta
acggaggtcattcaacaatgcaaagatgtccttgacgacgatgccattactgagattatc
aaatcgtgcaacgttatcaagaatgagaaggttcaggctgcaaaacgtgtgaagaaggga
caggcacaaaaatcaaagaaagctgacaagcaagcagcaaagaaggcgatggagattcat
gaggatgtgtttggagagagtaatcagtatgacgaatacgatgaaatgggcggtgcttat
gaggacgacttcttctaa

DBGET integrated database retrieval system