KEGG   Thalassiosira pseudonana: THAPSDRAFT_22897Help
Entry
THAPSDRAFT_22897  CDS       T01078                                 

Definition
(RefSeq) predicted protein
  KO
K11835  ubiquitin carboxyl-terminal hydrolase 4/11 [EC:3.4.19.12]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     THAPSDRAFT_22897
Peptidases [BR:tps01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THAPSDRAFT_22897
Ubiquitin system [BR:tps04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    THAPSDRAFT_22897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH DUSP zf-MYND USP7_C2 PHB_acc_N
Motif
Other DBs
NCBI-GeneID: 7444892
NCBI-ProteinID: XP_002290860
JGI: 22897
UniProt: B8C3S5
Position
5
AA seq 1078 aa AA seqDB search
MSSRASCETSASITSSNLAQSIRYKEDGNRFFNLKHYTAGIACYRRGLEELPCAIADKSS
NNRKSKEERDVEVALRSNLALLLLRLAEETTDNTAQSHEQRHQWYLECETECTTVLEVNP
SKAKIHYRRGHARSLLADCCKRDPLKQSEYWSGAESDFKQCEEVLQAQLEKNKWNDNVPT
QSTKDILKDIMAARKALQQIHSSRATVGRQKTKPKILASGGKQSFVVHTPTNDEMEVNAT
PNTKFVSSNLTTGYTPEHNRPTPIEQKEFIASLLSRQCSPNDESSIVATQTPIAGEAFFL
INMDWWQKWCQYVGFFTMYGGSDNKNNQNGESTRGASSKRELEEIDEMNARVLQLLPPGA
TIPQYIEMDRKDAITPTKKEDTHQQSSNVSLSSSSSSDDDSVTEGTMRISPGVIDNSSLI
LPDTNGVWYSKQCIEGNSNEDNKTVLLKNYLVRGYHFEVLPREAFAAFRCWYGETSPTLF
RRATIMNELPWISQKKQSTCLSVRLPLYTEQWNVILHNPNGQHLRTDESSTALCGACRAP
CATRLTCSKCHSVRYCRKECQRSHWSPYHKAVCRILSEQQQSGDANPNRGLIPESKVWGR
VGLNNLGNTCFMSSAVQCIGHVAPLTRYFLRDSFLDDINEHNALGTGGKVANAYAFTMKA
IWMGGHQHRSISPSALKRAIELFAPQFSGVQQQDSAEFVTYLLDALHEDTNRVRHPPYVE
FPDVDLSKKLSISGAEAWDKHCIRNSSEVFDTFYGLYKNACVCPICDTSYVKFETFNHLT
LEIPQRKAFDLEVILVRDFANTEEVSLPLRYCVSVPQDCTINDLKASLSKLSGVRRQMLA
ICSMKDNRISKLHKNNDHVSLLLNGGQIFAYEVTPVEEEDRTSFDSPEIHAFVNQCIIID
NKTRNLGVPFFVSFGKRIGCEEVYNRVWNYVKPFVIVGKEDDAPFQAMVKSKMRIRVVDQ
YFTTKDNITTQILPQSSSEQLVELLGYQIEDNVMELSLEWADIIDINSQPVHSGLVHISN
FYQVLNHSCVEEYHQRTQQHQNHSNVMTLDDCIASFIRPEWLDSENKRSRYGDFQTFS
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcacgtgcctcttgtgaaaccagcgcctccatcacgtcatccaatttagcacaa
tccatacgctacaaagaggatggcaatcgcttcttcaatctaaaacattacactgcaggt
attgcatgctaccgccgtggccttgaggagctaccgtgtgccatcgccgacaagtccagc
aacaacaggaaatcaaaggaggagagagatgtcgaagtagctttacgatccaaccttgca
ctgttgctgcttaggcttgccgaagaaacgacagataacacggctcaatctcacgagcaa
cggcaccagtggtatcttgaatgcgaaacagagtgcacaactgtattagaagtgaatcca
tcaaaggcaaagattcactaccgcagaggtcacgcacgttctctcttggcagattgttgc
aaaagggacccgctgaagcagtctgaatattggtctggtgcagaatctgattttaagcaa
tgtgaagaagttctgcaagcacaattggaaaagaacaagtggaatgataatgtacccacg
caatcaacaaaagacatactgaaagatatcatggctgccagaaaggctctacagcagata
cattcttcaagggctactgtcggtaggcaaaaaacgaaaccaaagattcttgcctccggg
gggaaacaatcatttgtcgtacacactcccaccaatgacgagatggaagtaaatgccacc
cccaataccaagtttgtttcatcaaacttgacaactggctacacgcccgagcacaataga
cccactccaatagaacaaaaagaattcatcgcaagtttgctatcgcgccagtgctctccg
aatgacgaatcatcaattgtggcaactcaaactcctattgctggagaagctttctttctc
atcaacatggattggtggcaaaagtggtgccaatacgttggattcttcacgatgtacggg
ggaagcgacaataaaaacaatcagaacggagagagtactagaggagcaagcagtaagcga
gaacttgaagagatagatgagatgaatgcccgtgtcttgcaactgcttccaccaggagca
actatcccacagtacatcgaaatggacagaaaggatgcaatcacgcctacgaagaaggag
gatacccaccaacaatcttcaaatgtttcattgtcatcttcgtcgtcgtcggacgatgac
agtgtcacagaaggcactatgcgaatttctcctggcgtgatagacaattcgtcgttgatc
ctacccgacacaaacggagtttggtacagtaaacaatgcattgaggggaacagcaacgag
gacaacaaaacagttctattgaaaaattacttggtgagagggtatcactttgaagtgctt
ccacgagaagcattcgccgcttttcgttgttggtacggagagacgtctcctactttgttc
cgtcgagcaactattatgaacgagctgccgtggatatcgcaaaagaagcaatctacatgt
ctttctgtacgcttaccactctacactgagcagtggaatgttatcttacataatcccaat
gggcagcatctacgcaccgacgaaagtagcactgcattgtgtggtgcttgtcgagcgcct
tgtgctactcgattgacatgttcgaagtgccactccgttcgatactgcagaaaggaatgc
caacgaagtcattggtccccgtaccacaaagcagtctgccgcatactatcggagcaacaa
cagtcgggtgatgcaaatcccaacaggggattaattccggagagtaaagtttgggggagg
gtggggttgaacaatctcggcaacacttgcttcatgagttctgctgtccagtgcattggc
catgtagcgccgttgactcgttacttcttgagggatagctttcttgatgacatcaacgag
cacaacgctctcggaacaggaggcaaagtggcaaacgcttatgcattcacaatgaaagcg
atttggatgggaggtcatcagcacagaagcatcagtccttcagcattgaaacgggcgatc
gaactctttgctcctcagttctctggtgtgcagcagcaagattctgctgagtttgtcaca
tatctgctcgatgcattacatgaagatacaaatagagtgcggcaccctccgtatgttgag
ttccccgatgttgatttgagcaagaaactttcaataagcggagctgaggcatgggacaag
cattgcattcgcaactcaagcgaagtctttgacaccttctatgggttgtacaagaacgct
tgtgtctgtcccatctgtgatacatcttatgtaaagttcgaaacattcaatcacctcacc
ttggagataccgcaacggaaagcattcgacctcgaggtcattctcgttcgtgattttgcc
aatacagaggaggtgtctttacccttgaggtattgtgtatcggtgcctcaagattgcacc
atcaacgatttgaaagcttcactcagtaagttatctggagtgcgacgtcagatgttggct
atctgcagcatgaaggacaatcgtatatccaagctacacaagaacaacgatcatgtgtcg
ttgctgctaaatggaggtcagatattcgcctatgaggtaactcctgtcgaagaagaagac
cgaacaagtttcgattcgccggaaatccatgctttcgtcaaccagtgcatcatcatcgac
aacaaaacacgaaatcttggtgttcccttcttcgtgtcttttgggaagcgcattggatgt
gaggaggtatataacagggtatggaattacgtgaagccgtttgttattgtaggaaaagag
gacgacgcaccgtttcaagccatggtcaaatcaaagatgagaataagagttgttgatcag
tattttacaacgaaggacaacatcaccactcagatccttcctcaatcctctagcgagcag
ttggtggaattacttggctaccagattgaagacaacgtcatggaattatctcttgagtgg
gctgatatcattgacatcaattctcaaccagttcattccggattggttcacatatctaac
ttttatcaggttttgaatcattcatgcgtggaagagtatcatcaacgtactcagcaacac
cagaaccactccaatgtcatgacgctcgacgactgcattgcatccttcattcggcctgag
tggttggattccgagaacaaacggtcgcgttatggagacttccaaacgttctcgtaa

DBGET integrated database retrieval system