KEGG   Thalassiosira pseudonana: THAPSDRAFT_23958Help
Entry
THAPSDRAFT_23958  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_23958
Enzymes [BR:tps01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     THAPSDRAFT_23958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 330 aa AA seqDB search
MIWQPPRPSPPPYTLLPSLTLSLPSSLHAMSNEPIKVKHTASGATFTINPYGAHLTSYTT
PTGREILFLSRDAILDGSKAIRGGIPLCFPQFGQPDESYPQHGFLRNNYWNVVDGSQFDT
EEGAGISMELELKNVVHSRGGKWDVVDTKLDCKCIFSVEVDGKSMTNTITIVNQGTETFD
FQVLLHAYYLVADRKALDGGVCNVKGLEGYSVSDKVSGEDYVLGAEPVIIPETIIDRVYN
PPKDKIDLQVIVSAGPNNTISLKANGQVDGTAVPVSGVVWNPHAEKAKDMGDFGDDQYVD
MICVEPGLLSDVPLLEGGKSATFTQVMTSI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgatctggcaacctcctcgtccctctccaccgccatatacccttctaccctctctcacg
ctttcgttgccttcctctctccacgccatgtccaacgaaccaatcaaagtaaaacacacc
gcttcaggtgccaccttcactataaacccctacggtgcacatcttacgtcctacaccacg
cccaccggtcgcgagattctctttctgtcacgagatgcaattttggatggatcaaaagcc
atacgtgggggtattccactctgctttccacagttcggtcagcctgacgaatcttatccc
cagcatgggttccttcgtaacaactattggaatgtcgtggatggatcgcagtttgatacc
gaggagggagctgggatatcaatggagttggagttgaagaatgtggttcattcgaggggt
ggaaagtgggatgttgttgatacaaagttggattgcaagtgcatcttttctgtcgaggtt
gacggaaagagcatgacgaatacaatcaccatagtgaatcaagggacggagacgtttgac
tttcaagtgctgcttcatgcgtattacttggtggctgatagaaaggcattggatggaggg
gtatgcaatgtaaagggattggaaggatactcagtttctgacaaagtatcaggtgaagat
tacgttcttggagccgagccggtcattattcctgaaacaatcattgatcgcgtatacaac
ccgccaaaagataagattgacttgcaggtgattgtatcggctggaccaaacaatacaatc
tctttgaaagcaaatggtcaagtggacgggacggcagttccggtttctggggtggtgtgg
aatcctcatgcagagaaggcaaaggatatgggagattttggagatgatcaatatgtggat
atgatttgtgtggagcctggtttgttgagtgacgtaccgttgttggagggtggaaagagt
gcgacatttactcaggtgatgactagtatctga

DBGET integrated database retrieval system