KEGG   Thalassiosira pseudonana: THAPSDRAFT_24331Help
Entry
THAPSDRAFT_24331  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
tps  Thalassiosira pseudonana
Brite
Enzymes [BR:tps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     THAPSDRAFT_24331
Transcription factors [BR:tps03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    THAPSDRAFT_24331
Mitochondrial biogenesis [BR:tps03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    THAPSDRAFT_24331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1718 aa AA seqDB search
MGPYEGASSAQQNNGSRPPHNQMQGHPSQQQPPQHGGGGGQMPPNGHHQMGNPYGGYHPL
NMQQGGQPQQQQNGMMGGGGGVTMGGFNMQGSNGGMSMGGNNGQQHRGMHPMSMQSGGGG
SQYGGPGGGGGNNNMYNHPNFNSGNQPGGGGHHHGGYNPHQQQIQQQQLGGYNPQMMAQM
QQSHNSQYNPMQQMGQRSHQQQQQHQGGYHPQPQIPLPQAQAYGQQQQQLHPSNSYARQA
SSASIHSSIAVANDSSPSPSDNMQLLSYKEAPNFSEVTGVDIGDEDYGQQFLPTGLNGDW
QSDRDMHHRREMIQHIVKLLKQKDKSASPEWLTKLPQMVKQLEVSLYRSAPSFEAYSDTN
TLKHRLQQLAMEIARKTQQAKASGRSSSRGDRIPGMGNMHYNPVNMGANEEIVSSQYGNP
NDPEWKVRIRHKQQRLLLLHHSSKCPYDNDKCKVTPYCGEMKKLWKHMARCTDNECRVPH
CFSSRSILSHCRKCKDPGCPACGPVRETVRKTQKSNAGKGVNEGQGDFGGMGPNSGIGLG
GMGNEMGGGGGSGMGGNDMMGGMPMMGGNMNQMPKRQPSQPMPWKGDINSMPNFPPPNIR
QQQDDYMAFPEGFPEGQQVLNGPSSGQSGNPESSKARHKQQRLLLLRHASKCNAEPGRCT
TTPHCAEMKVLWKHIANCKDQYCKVKHCMSSRYVLSHYRRCNDPGCEICGPVREIFKSGT
NHFIHDPSFMPGSSAADLITPPLPEGPQTKRSRTNDPSMNGMHHTAPARPAFPLSAPTSG
SENHAKLKSSAKPSSSNATEEHSLLECFTTEQVKTHIQSLKKTIEVSPAKLKLKCVEILR
ELQIHEHGWVFATPVDPVELGLDDYFDVIKKPMDLGTISRRLDNGSYHAFDDFKSDVRLT
FENAMKYNDENSVVHEMAKELKKKFDTDYKKLMKQLEKEHRENSMRQQACGLCGCEKLNF
EPPVFFCNGMNCPSKRIRRNTHFYITADKQYAWCSQCYNELGGEIDLGTSVLKKVDLAKK
KNDETHEESWVQCDDCERWIHQICGLYNTRQDKENKSAYSCPLCLLDKRKKEGEPKKLPP
PPAASDIPRTNLSDWLERDVHKKVNQRLKELAQEKADTEHIAFEKAYADLSAGGPLTIRQ
VTSTDRKLEVRDQMRQRYAHKNYPEEFPYRCKCIVVFQNIDGVDVVLFALYVYEHGDDNP
FPNKKTVYVSYLDSVHFMKPRQMRTFLYHEILISYLDYARQKGFLQAFIWACPPLKGDDY
IFYAKPEDQKTPKDVRLRQWYLDMLVECQKRNIVGMVSNMYDQYFANKSLDAASVPYFDG
DYFPGEAENIIKDLEESNSKRKGGAGKKNKDPSKSKAAPSGDAEFVGEKCYKEGGRDPVM
QKFCDAIQGMKESFIVAYLNAKDAKPEHLVVPKKIMEFREANKLLMIDDDPKKKKEDGTE
EKKDDEKPQSKKRDADGYEVAASEKPPANKQLNSKGKPVRVLNDDDEEIDCEFFNTRQCF
LDLCRGNHYQFDELRRAKHTSMMVLWHLQNREAPKFVQQCMACNREIASGIRHHCNVCSD
FDLCDDCFRDPDTNRGTCNHKLEAIKVDTAQSENSGLTEEQRKERQRNIQLHITLIEHAS
RCNSSSCKSSNCMKMKSYLKHGSTCTVKASGGCKICKRIWTLLRIHAQQCKSSSCAIPQC
IAIRKRIRQLQLKQQAMDDRRRQEMNRHYRMGMMSSDN
NT seq 5157 nt NT seq  +upstreamnt  +downstreamnt
atgggtccctatgaaggcgcatcttcagcccaacaaaacaatggatcacgaccccctcac
aatcagatgcaagggcatccctcccaacagcaaccgccgcagcatggaggaggagggggt
caaatgcctcccaacgggcatcatcaaatgggcaatccgtatggaggatatcatccactt
aatatgcagcagggaggtcaaccgcagcagcagcagaatggaatgatgggaggcggggga
ggcgtaaccatggggggatttaacatgcaaggcagtaacggaggtatgtccatgggtggg
aataatggtcaacagcacagggggatgcatccgatgagtatgcaaagcgggggaggtggg
agtcaatacggaggaccgggaggaggagggggtaacaacaacatgtacaatcatcccaat
tttaactctgggaatcagcctgggggaggaggacatcatcatgggggatacaatccccat
cagcaacagatacagcagcaacagcttggtgggtacaatccccaaatgatggcgcagatg
cagcagtcacacaattcgcagtataatccgatgcaacagatgggtcaacgttctcatcaa
caacaacagcagcatcagggtggatatcatccacagccacagatcccccttcctcaggcc
caagcctacggccaacaacagcagcagttgcatccatccaactcctacgccagacaagcc
tcctctgcatccatacattcatctattgccgtggccaacgacagcagtccctcaccctcg
gacaacatgcaacttctttcatacaaggaggctccaaacttttcagaagtaacgggagtc
gatataggggatgaggattatgggcagcaatttttgcccacggggttgaatggggattgg
cagagtgatcgggatatgcatcacaggagggagatgattcagcacattgttaagctgctg
aagcagaaagacaagagcgcttcccccgagtggctcaccaaactccctcagatggtgaaa
caactagaagtgtcactctaccgttcagctccctcctttgaagcgtattccgacaccaac
accctcaagcatcgtctacaacaactggccatggaaattgcgaggaagactcaacaggcc
aaggcgagtggaaggtcgtccagcaggggtgatcgtattccaggaatgggcaacatgcac
tacaaccctgtcaacatgggagcaaacgaggaaatagtcagcagtcaatacggcaatcca
aatgatcccgaatggaaggttcgtatccgtcacaagcagcaacgtctactgctcttgcac
cactcctccaaatgcccctacgacaatgacaagtgcaaggtcactccctattgcggcgag
atgaagaaattgtggaaacacatggcgcgttgcacagacaatgagtgtcgagtgcctcac
tgcttctccagtcgatctattttgagtcattgtcgtaaatgcaaagatcctggatgtcct
gcctgcggtcctgtcagagagacggtgcgaaagacgcaaaagagtaacgctggtaagggt
gtgaatgaaggtcaaggtgattttggtgggatgggtccaaatagtggaattgggttggga
ggaatgggtaatgaaatgggcggcggtggtggcagtgggatgggaggcaacgacatgatg
ggtggaatgccaatgatggggggaaacatgaatcaaatgccaaagaggcagccttctcag
ccaatgccttggaaaggggatatcaatagcatgccaaacttcccaccgccgaatataaga
cagcagcaggatgactacatggctttcccggagggtttccctgagggacagcaggtgctc
aatggaccgagctctgggcagagtgggaatccagaatcgagcaaggctaggcataagcag
caacgtcttctccttcttcgtcatgcatcaaagtgtaatgcagagcctggtcgctgtacc
accactccacactgtgctgaaatgaaagtcttgtggaaacacatcgccaattgcaaggat
cagtattgcaaggtgaaacactgcatgagcagtcggtatgttctcagtcactatcgtcgg
tgcaatgatccgggatgtgagatttgcggtccggtgagggagatttttaagagtggcacg
aaccatttcattcatgatccgtcctttatgccaggatcatcagcggctgatctcatcact
cctcctctcccagagggaccacaaacgaagaggtcgaggactaacgatccttcaatgaat
ggaatgcatcataccgcgcctgctcggccagccttccctctaagtgctcctacatctggc
tcggagaatcatgccaagttgaagtcttcagcgaagccttcgtcatccaatgccacggaa
gagcactctttattggaatgttttacgacggagcaggtcaagactcatatccaatcactg
aagaagacgatagaagtgtcacccgccaagttgaagctcaagtgcgtggaaatattgaga
gaactccaaattcacgagcatggttgggtgtttgcaacgcctgttgatcccgtcgagctg
ggtcttgatgactactttgacgttatcaaaaagccgatggatcttggaactatcagtagg
aggcttgacaacggatcgtaccatgcctttgatgacttcaagtctgatgttcggcttact
tttgagaacgctatgaaatacaatgatgagaattcggtagttcacgaaatggcaaaggag
ttgaagaagaagtttgatactgactacaaaaagctaatgaagcagctggagaaggagcac
cgagagaactccatgaggcagcaggcgtgcggcctttgtggttgcgaaaagctcaacttt
gagcctcccgtgttcttttgcaacggtatgaactgtcccagtaagcgcatccgtcgtaac
acccacttctacatcacggccgacaagcagtatgcttggtgcagccaatgttacaatgag
cttgggggagagattgacctcggtacgtcagtcttgaagaaggtggaccttgcgaagaag
aagaacgacgagactcacgaggagagttgggttcagtgtgacgattgtgagcgatggatc
catcagatttgtggactctacaacacacgtcaggacaaggagaacaagagtgcctattct
tgtccactatgcctgctggataagaggaagaaagaaggagagcctaaaaagctcccacct
cctcccgcagcgagcgacattcccaggacaaatctgtcagattggcttgaaagggatgtt
cacaagaaggtaaatcagcgtctcaaagagcttgcgcaggagaaggccgatactgagcac
attgcctttgaaaaggcgtatgctgatctttctgctggggggcctttgaccattcggcag
gtgacgtctactgaccgaaagttggaagttcgcgatcaaatgaggcagcgatatgctcat
aagaactatcctgaggagtttccctaccgttgtaaatgcattgttgtcttccagaacatt
gatggtgttgacgtggttctttttgcgttgtatgtttacgagcatggagatgacaatccc
ttccccaacaaaaagacggtgtatgtgtcctaccttgacagtgtccacttcatgaagcca
aggcaaatgaggacgttcctttaccacgaaatcttaatctcctaccttgactacgctcgt
cagaaaggcttcttgcaggccttcatttgggcgtgcccaccgttgaagggggacgattac
atcttctacgcaaaaccagaggatcaaaagactcccaaagacgtaagacttcgtcaatgg
tatcttgatatgctggtggagtgccagaaacgcaacatcgttggtatggtctccaatatg
tatgatcaatactttgccaacaagtctctggatgcagcgagtgtcccctactttgacgga
gattacttccctggagaggctgaaaatatcatcaaagacttggaagaaagcaacagtaag
cgcaagggtggtgctggcaagaaaaataaggatccttcaaagagcaaagctgctccatct
ggtgatgcagagtttgtgggtgaaaagtgctacaaggagggtggtcgtgatcccgtgatg
cagaagttctgcgacgccattcaggggatgaaggagagtttcatcgtcgcatacttgaac
gcaaaggacgccaagcctgagcatcttgtcgtaccgaagaagattatggagtttagggaa
gcaaacaaacttctcatgatcgacgatgatcctaagaagaagaaagaagatggaacggag
gagaagaaggatgacgaaaagcctcagagcaagaagcgcgatgctgacggttacgaagtc
gccgcctcggaaaagccaccggctaataagcaactcaatagcaagggaaagcctgtccga
gtattgaacgacgacgatgaagaaattgactgtgaattctttaacacgcgacaatgcttt
ttggatctctgccgtggtaaccactatcagtttgatgagttgcgacgggcaaagcatacg
tcaatgatggttttgtggcaccttcaaaatcgtgaagcgccaaaattcgttcagcagtgc
atggcatgcaaccgcgagatcgcgtctggcattcgtcatcattgcaacgtatgctcagac
tttgacctctgtgacgattgcttccgagatccagacaccaacagaggcacgtgcaatcat
aagcttgaggcaattaaagtggatactgcccagagtgaaaacagtggactcaccgaggag
caacgaaaggagcgtcagcgaaacatccagcttcatatcactctcattgagcatgcatct
cgttgtaactcgtcttcctgcaagtcttccaattgtatgaaaatgaaatcctacctcaag
cacggctcaacgtgcacggtcaaagcatcaggaggatgcaagatttgcaagagaatctgg
acgttgttgaggattcacgcacagcaatgcaagagctctagctgtgccatcccgcaatgt
atcgcaattagaaagcgtatccgtcagcttcagctcaagcagcaggctatggacgaccgt
agaaggcaagaaatgaaccgacactaccgcatgggaatgatgtcctctgataactga

DBGET integrated database retrieval system