KEGG   Thalassiosira pseudonana: THAPSDRAFT_24501Help
Entry
THAPSDRAFT_24501  CDS       T01078                                 

Definition
(RefSeq) predicted protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tps  Thalassiosira pseudonana
Pathway
tps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tps01100  Metabolic pathways
tps01110  Biosynthesis of secondary metabolites
tps01130  Biosynthesis of antibiotics
tps01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THAPSDRAFT_24501
Enzymes [BR:tps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     THAPSDRAFT_24501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS Phage_holin_7_1
Motif
Other DBs
NCBI-GeneID: 7447559
NCBI-ProteinID: XP_002293205
JGI: 24501
UniProt: B8CAE6
Position
12
AA seq 368 aa AA seqDB search
MSSAQAHRRPLALMAITFTAFAASPIYSFVPSAVRPVSSPHTASPATTTSLDAIGVFVRK
AKEADVRKYCEEGPSESVLALLKQINDAPDEAADDATTTVGEVQGLLTKRKGTISIIAEY
KRKLEGSGFLSEILPPEILSPVFREFGATAVAVLADERTGGCTYDDIVEMVEEQQEAMGE
VPGPLPVISSDLIVDEIQIARAADAGAKAVTVTHGVVGEEKVSQFIKNARVLGLETIVNV
GTAEEAQSAVDVGASIISVTGVDGADNKFAVIESLSVPEGRTVCTIANILAKDNKALEEV
EEAWICRDRGFNCVWVSDALYKSGNDPVEHPGAIISSMRAKSSVKYASPKARSGKGEGAR
EYLGDILM
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgcacaagcacaccgccgaccactggccttgatggccatcaccttcacagcc
ttcgcggcatcccccatctacagcttcgtacccagcgccgtacgaccagtgtcttccccg
cacacagcatcaccggcaacgacgacatcgctcgacgcaatcggtgtctttgtacgcaag
gccaaggaagccgacgtgcgcaaatactgtgaggagggaccctcggaatctgtgctggca
ctcctgaaacaaatcaacgacgcgcccgacgaggctgctgacgatgcaacaacaacggtg
ggtgaggtgcagggtctcctcaccaaacgcaaaggaacaatctcaatcattgccgagtac
aaacgtaaattggaaggaagtggctttctctctgaaatcctccctccagagattttatct
cccgtctttcgcgagtttggtgctactgctgttgccgttctagctgatgagcgtacgggt
ggatgtacctacgatgacatcgtcgagatggtggaagaacaacaagaggcaatgggtgaa
gtccctggtccgctgcccgtgatttcgtcagatttgattgtggacgagattcaaattgca
cgggctgccgatgcaggtgccaaagctgtcactgtcacgcatggggtggtcggtgaagag
aaggtgtcgcaattcatcaagaatgcacgtgtacttggattggaaacgattgtgaatgtc
ggtacagccgaagaagctcagagtgcggttgacgtgggagcttccatcattagtgtcacc
ggagtggatggtgccgataacaagtttgctgttattgaatcactctccgtacccgagggg
agaaccgtatgcacaattgccaatatcctcgccaaggacaacaaggctctggaagaagtg
gaagaggcgtggatctgtcgtgataggggattcaactgcgtgtgggtgagtgatgctctg
tacaaaagtggaaacgatccagtagaacaccccggtgcaatcatcagcagtatgagggcc
aagagttctgtcaagtatgctagtcccaaagcaaggagtggaaagggcgagggtgctagg
gagtacttgggtgacattcttatgtaa

DBGET integrated database retrieval system