KEGG   Thalassiosira pseudonana: THAPSDRAFT_24501Help
Entry
THAPSDRAFT_24501  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tps  Thalassiosira pseudonana
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THAPSDRAFT_24501
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THAPSDRAFT_24501
Enzymes [BR:tps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     THAPSDRAFT_24501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12
AA seq 368 aa AA seqDB search
MSSAQAHRRPLALMAITFTAFAASPIYSFVPSAVRPVSSPHTASPATTTSLDAIGVFVRK
AKEADVRKYCEEGPSESVLALLKQINDAPDEAADDATTTVGEVQGLLTKRKGTISIIAEY
KRKLEGSGFLSEILPPEILSPVFREFGATAVAVLADERTGGCTYDDIVEMVEEQQEAMGE
VPGPLPVISSDLIVDEIQIARAADAGAKAVTVTHGVVGEEKVSQFIKNARVLGLETIVNV
GTAEEAQSAVDVGASIISVTGVDGADNKFAVIESLSVPEGRTVCTIANILAKDNKALEEV
EEAWICRDRGFNCVWVSDALYKSGNDPVEHPGAIISSMRAKSSVKYASPKARSGKGEGAR
EYLGDILM
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgcacaagcacaccgccgaccactggccttgatggccatcaccttcacagcc
ttcgcggcatcccccatctacagcttcgtacccagcgccgtacgaccagtgtcttccccg
cacacagcatcaccggcaacgacgacatcgctcgacgcaatcggtgtctttgtacgcaag
gccaaggaagccgacgtgcgcaaatactgtgaggagggaccctcggaatctgtgctggca
ctcctgaaacaaatcaacgacgcgcccgacgaggctgctgacgatgcaacaacaacggtg
ggtgaggtgcagggtctcctcaccaaacgcaaaggaacaatctcaatcattgccgagtac
aaacgtaaattggaaggaagtggctttctctctgaaatcctccctccagagattttatct
cccgtctttcgcgagtttggtgctactgctgttgccgttctagctgatgagcgtacgggt
ggatgtacctacgatgacatcgtcgagatggtggaagaacaacaagaggcaatgggtgaa
gtccctggtccgctgcccgtgatttcgtcagatttgattgtggacgagattcaaattgca
cgggctgccgatgcaggtgccaaagctgtcactgtcacgcatggggtggtcggtgaagag
aaggtgtcgcaattcatcaagaatgcacgtgtacttggattggaaacgattgtgaatgtc
ggtacagccgaagaagctcagagtgcggttgacgtgggagcttccatcattagtgtcacc
ggagtggatggtgccgataacaagtttgctgttattgaatcactctccgtacccgagggg
agaaccgtatgcacaattgccaatatcctcgccaaggacaacaaggctctggaagaagtg
gaagaggcgtggatctgtcgtgataggggattcaactgcgtgtgggtgagtgatgctctg
tacaaaagtggaaacgatccagtagaacaccccggtgcaatcatcagcagtatgagggcc
aagagttctgtcaagtatgctagtcccaaagcaaggagtggaaagggcgagggtgctagg
gagtacttgggtgacattcttatgtaa

DBGET integrated database retrieval system