KEGG   Thalassiosira pseudonana: THAPSDRAFT_24683Help
Entry
THAPSDRAFT_24683  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
tps  Thalassiosira pseudonana
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 1752 aa AA seqDB search
MNPNYKNGPDAIYDTDDTTTTTPYDENKEYYPRLKRAPYLFDVVSSDFGIRQTRFAHLGS
VGEGEMWDASLKDEGDGGTLRNTGGSTLNPRTPTKSNSSTNLSTPQPMKRRSSLARVFST
LGMSPGSTISEGAMTPSAGWDGGGGGGDSETNPNTLIPPRFRRGSSAEVNTVRAGSIDLG
GGGTSTRDRLGSRGNMNISKIPRWALHDPCAIVMKDGVPVLMGTLVHHHLLLSQSQSPFV
SPHFVVTPTWRLKERMKTVGICLILALNVGTDPPDLNKPNPCAKLQCWLDPTSISRAKAK
ERIGERLEQQYAKWQQRSKLKYRRAIDPTVEIVKDLCFRMRESAKGERVLLHYNGHGVPR
PTVNGEIWLFDKHHTNYIPLSVTDLRRWIGKPSIVVLDCSGAGVLMPFFTAPLSDGGDFL
QRSTSNTMDSSDPSEGGQEYSYLRAIRDTIVLCPTSQGEWLPLNPEFPADIFTSCLTTPI
PIALRWFVYQNPLSMEFIDLETIADAIPGKLTDRKTPLGELNWIFTAVTDTIAWNVLPSA
LFQRLFRQDLLVASMFRNFLLADRILRSLGCSPMSNPELPSTCNHPLWQAWDLAVETCLH
QLIDHGYLTRKGSVTAATTKAGTPADDGEGLEKSNSIESEKPTGGGGHSPLPAVANVSYT
VDAPFFAEQLTAFEIWLEYASAKPKSKLLIRCPPSAIGGTPLPFLHGSMGGDGASTASPY
ELDPPQELPIVLQVLLSQAHRVRALVLLKRFLDLGPSAVNLALSVGIFPYVLKLLQSPID
EYKHVLVGIWAQVLAFDESCQVDVVKDGALPHFIRHLRWGLTPSPTNKNLSARQNAVPPS
SACFEDAVEQRTMAAFILSVICLGYTLGQSECINAKLHLAIGTLLQSLESQDDDERMKSE
DDLSPQFRMWLCICLGNLMKDNVAAEAELYACGLQFRLFARLEDYSPEVRTASCYALSCL
VGSAPEKPTVDDSQPITSMMHRNQQYQAQQILMQPFNQGTMSMPGMNVNLNPSAMMTSNM
VPPPYGLHPPDFQTQMGSNINPTAKPSFLAPVSDQPIMLAPMQPAQSYQQSEVSTVFEDK
QRMDNDLTVASKLSQVLGDASPVVRFEAVLALTRFVGKYLAAFVSAVGNDVVSPPQVRSV
LGGNIQTIPLPNGVSPDAEMKLSGIWSSLFRLHRSDPHPSIRLIVHSLVSSINERVMTER
TKLRQRSSGRRRSMASSLTDDAADAREKIRRNATGINLSSQGGSPPQSLKRSGSIGFTIL
QDGSSTPASSRGMHMNQGSLAFDIADPEFFLPESKFYLWKKVEFADSDNSGDTKNTSDAL
SDAGAIKKYRETRNRLVQQKGQLLKDSFAVLAQKPPTNSPSPFGDWEKGGGDAASGAEQE
LDLKKQALHLQQVSLLKNTTARGTTSLLLFHPYEPALVVCGGHDNVTCWNVEGKAERMLS
FSNENPKQTRMTAAAWINETNTSLLLTGSNDGSVRIWDGLFEPNDELSKEKPSLVSSFFA
APDISSDKRYSSGLVLEYQQFGGQLVAGGNTKLIRCWDIATEKCRNTFESKSDASLTTLT
TAWNHSYNGYSGLGPDIIVGGYGNGSLRVFDTRCNRGEPAMNIQEGGVANRGLATKRRWK
YSEYDEHSSWIVDVSFTTYGGRHELVSGSVAGNIKFWDLRYSSSIRTLEHKMQMTALAAH
SNVPMFAVGSPAQFIKLMSHDGATQQVIRYHEKVSGQRIGPVSCLSFHPQMPYLAAGFAD
ELVGVYAPRGAF
NT seq 5259 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaaactacaagaacggcccagacgcaatctacgataccgacgatacaacaaca
acgacaccatacgacgaaaacaaagaatactacccccgtctcaaacgagccccctacctc
ttcgatgtagtctcatccgactttggcatacgtcaaaccagatttgcccacctcggatcc
gtgggagaaggtgagatgtgggatgcttcgctaaaagatgagggtgacggtgggacgttg
cgaaacacgggaggttctaccttgaatccgaggacgcctaccaagtctaattcgtcgact
aacttgtcaacgccacagccgatgaagaggcgtagttccctcgcgagggtgttttccacg
ttgggaatgagtccggggtcgactatatcggaaggagcaatgactcctagtgcgggatgg
gatggtggtggagggggtggagattctgaaacgaaccccaacacgctcattcctccgaga
tttcgtagggggtcatcggccgaagtcaacacggtacgggcaggctccatcgatttggga
ggtggtgggacatccacgcgagatagattgggaagcaggggtaatatgaatatcagcaaa
atacctcgttgggcacttcatgatccttgtgcgattgttatgaaggatggtgtaccagta
ttaatgggaacacttgtgcatcatcacttgcttctctctcaatctcaatcgcccttcgta
tcgcctcatttcgtcgtaactccaacatggcggctgaaagagaggatgaagactgtgggg
atctgtctcattcttgccctcaacgttggtaccgatcctccagacttgaacaaaccaaat
ccctgcgccaagctgcaatgttggcttgatccaacgtctatatctcgtgccaaagccaaa
gaacgtatcggagaacgattggaacaacaatatgctaagtggcagcagaggtcaaagttg
aaataccgtcgagcgattgatcctacggttgaaattgtcaaggacttgtgcttcagaatg
agagagtctgccaaaggagaacgagtgctactgcattacaacggacacggtgtgccgagg
cctaccgtgaatggtgagatttggttattcgacaaacaccacacaaactacatccctctc
agtgtcacagatttgcgtaggtggattggaaagccttccatcgtagtattggattgcagt
ggtgccggagtattgatgccattcttcactgcccccctgagtgatggtggagatttcttg
caacgttcaacttcaaacacaatggacagttcagatccaagcgagggtgggcaggagtat
tcataccttcgagctattcgtgataccattgtcttgtgtcctacatctcaaggagaatgg
cttcctcttaatccagagtttccggcagatatcttcacttcatgcctgacaacgcccata
cccattgctcttcggtggtttgtgtatcagaatcctcttagcatggaattcattgatctt
gagactattgctgatgcgattccaggaaagttgactgaccgtaagacgccgttgggagag
ttgaattggatattcactgccgtcaccgataccattgcgtggaacgttcttccaagtgct
ctattccagcgtctctttcgtcaggatctgttggtggctagcatgttcaggaacttcctt
ttggctgacagaattctcagaagcttgggttgcagcccaatgagcaatccagagttgcca
agtacatgtaaccatccgttgtggcaagcttgggatttggccgttgagacgtgtttacat
cagttgattgatcatggttatttgacaaggaaagggtcggtgactgctgcaacaacaaag
gctggaactcccgccgacgatggcgaggggttagagaagtccaactccatcgagagtgaa
aagccaacaggaggaggaggtcatagcccacttccggccgtcgccaacgtctcttatacc
gttgacgctccgttcttcgcagaacaactcactgcctttgagatttggcttgaatatgca
agcgctaaaccaaaaagcaaactcctcatcaggtgtcctcccagcgctattggtggaact
cccttgcccttcctccatggttcaatgggaggagatggagcatctacggcatcaccttat
gagctggatccaccccaagagttaccaattgtgttgcaggttctcttgtcacaggcacac
cgagtaagggcattggtgttgctaaaacggttccttgatttaggtccatcagccgtgaat
cttgcactctccgttggtatcttcccttacgtgctcaaactactacaatcaccgattgat
gagtacaaacatgtgctagttggcatatgggcacaggtgctagcgtttgatgagagctgc
caagttgatgttgtaaaggatggagctttacctcactttattcggcatcttcgttgggga
cttactccgtctccaactaataagaacctttctgcacgtcaaaacgcagttcctccatca
tcagcttgttttgaggacgcggtggagcaacggaccatggctgcattcattctgtctgtt
atttgcttggggtatacgcttggtcaatcagaatgtatcaatgcgaagttacatttggcg
attgggacgttgctgcaatcacttgaaagccaggacgatgacgagcgaatgaaatctgaa
gatgatttgtcacctcagtttagaatgtggctttgcatatgtttggggaacttgatgaag
gacaacgttgcagccgaagctgaattgtatgcgtgtggactgcaattcaggcttttcgca
agattagaagattattcgccagaagtgcggactgcttcgtgctatgccctatcttgtctc
gttggttcagctcctgaaaagcctaccgttgacgatagccagccaattacatcaatgatg
caccgcaatcagcaataccaagcacagcagatattaatgcagccattcaaccaagggacg
atgtcaatgcctggcatgaatgtcaacttaaatccatctgcaatgatgacttccaacatg
gtaccaccgccgtatgggctccatcctcctgatttccagactcagatgggaagcaacatt
aacccaacagcaaaacccagctttttggcaccagtgtcggatcagccaattatgttagca
ccaatgcaacctgcccaatcttatcaacagtcagaagtaagcactgtatttgaagacaaa
caacggatggataatgacctcacagtagcatccaagttatctcaggttcttggagatgct
agtcctgtggttagatttgaagctgtccttgcactgactagattcgttggaaagtatctc
gctgctttcgtctcggctgtgggaaacgacgttgtaagtcctcctcaggttcgcagcgtc
ttggggggaaatattcaaacaataccactgccgaacggtgttagccctgatgcggagatg
aaactctctggtatttggtcgtcgttgtttagactgcacaggagcgatcctcatccgtca
attcggttgatagtgcactcattggtgagttctatcaatgaacgtgtaatgacagagaga
acaaagttacgccaacgttcaagcggtagacgacgttccatggccagttcgttgacagat
gatgcagctgacgcaagagagaaaattagacgcaacgccactgggattaacttgtcttct
caaggaggatctcctccgcaatcgttgaagcgatccggctctatcggttttactattttg
caggatggcagcagtactcccgcgtccagcagaggtatgcatatgaatcaaggctcgttg
gcatttgatattgctgatcccgagttctttcttccagagtcaaagttctacttgtggaag
aaggttgagtttgcagatagtgacaacagcggtgacacgaagaatacatcagacgcactt
agtgatgctggtgcgataaagaagtaccgagagactagaaatagactcgtacaacagaaa
ggccaacttcttaaagattcctttgcggtgttagcgcagaaacccccaacaaactcgcca
tctccatttggcgattgggaaaagggtggtggagatgcagcatcaggtgctgaacaggag
ttagacttgaagaaacaagcattgcatctccaacaagtctcattgctgaagaatacaact
gctcgcggcaccacatctctccttctttttcatccgtatgaacctgcattggtagtatgt
ggaggacatgacaatgtaacttgttggaatgtcgaggggaaggctgaacggatgctatcc
ttttcaaacgagaaccctaagcaaactcgaatgactgctgcagcatggatcaatgagaca
aacacaagtcttttgcttacaggaagcaacgatgggtcggtgcgaatatgggatggtctc
ttcgagccgaacgacgaattgagtaaggagaaaccgtctctcgtgtcttccttctttgca
gctcctgatatatcctccgacaaacgatatagctctggtcttgtgcttgagtatcagcag
tttggaggtcagctcgttgcgggtggaaatactaaactcattcggtgctgggatattgct
acggaaaagtgtcggaatacttttgaaagcaagagtgatgcatcgctgacgacactcacc
actgcgtggaatcacagttataatggttattctggcctcggacctgacatcattgttggg
ggttatggaaacggttcgttacgtgtatttgacacacgatgcaacagaggcgaaccggct
atgaacattcaagagggaggtgttgcgaaccgtggccttgcaactaaaagacgttggaag
tattctgaatatgacgaacattcgagctggattgtggatgtatccttcacaacgtacggt
gggagacatgagttggtatccggcagtgttgcaggcaacataaagttctgggatttacgt
tacagcagcagcatcagaactcttgaacacaagatgcaaatgacagcactagcagcacat
tcaaatgtacctatgttcgcggttggatctcctgcacagttcatcaaactcatgtctcat
gatggcgcaacacagcaggtgatcaggtatcacgaaaaggtttcaggccagcgtataggt
ccagtcagctgcttgagttttcacccacagatgccctatcttgccgctggatttgctgat
gagcttgtcggtgtctatgctccgagaggggcgttctaa

DBGET integrated database retrieval system