KEGG   Thalassiosira pseudonana: THAPSDRAFT_24744Help
Entry
THAPSDRAFT_24744  CDS       T01078                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
tps  Thalassiosira pseudonana
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:tps03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 271 aa AA seqDB search
MPELPEVEKFRQILLPLTAAVTKSKVNSSSSSSACTITIACPSPTPPKVFPSQNDIDAIN
RGGYAVGDVLRKGKVLCIVLKKQTQSAAAERATKRRRTNGDTDSCNITGNEPTIYLSLHM
GMTGRISSPGNVPSLESLSECDEYPPPHTHMIIKSTESEACFSDPRRFGSASVFGVWCEG
GDLIPSFKDLAPDALESSAGYSCANDVSKMGRKIAEQLSNQRRGIKAVLLDQRAVVSGVG
NWVADEILYRSKLHPDQSFLNVQESQRVVGE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcttccagaggtggagaagtttcgtcagatcttgcttcctctaactgcagct
gtcacgaaatcaaaggtgaattcctcctcttcttcgtcggcatgcacaatcaccattgca
tgcccatccccaacgccacccaaagtatttccatcccaaaacgatatcgatgcgatcaac
agaggtggatacgccgtgggtgacgtgttacgtaagggaaaggtgttgtgcatcgtgttg
aagaagcaaactcaaagtgctgctgcagagagagctacaaagaggcgacgcacaaacgga
gacactgatagttgcaacatcaccggcaacgaaccaacaatctatctgtcacttcacatg
ggcatgacggggcggatatcatctcctggaaacgtgccaagtctcgaatcgttgagtgaa
tgtgatgaatatccacctcctcacacccacatgattatcaaatcgaccgaaagtgaggct
tgcttttcagatccgcgaagatttggatcggccagtgttttcggtgtgtggtgtgagggc
ggcgatttgattccatcattcaaagatctcgctcccgatgcactggaatcatcagctgga
tattcttgcgcaaatgatgtcagcaagatgggacgcaaaattgcagagcaactatcaaac
caacgtcgaggtatcaaggcagtgctacttgatcaacgtgcagtagtgagtggggtgggg
aactgggtggctgatgaaatactgtatcgttcaaagcttcatcccgatcaatctttcttg
aacgtgcaagagtctcaacgtgtagtaggtgagtga

DBGET integrated database retrieval system