KEGG   Thalassiosira pseudonana: THAPSDRAFT_2525Help
Entry
THAPSDRAFT_2525   CDS       T01078                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
tps  Thalassiosira pseudonana
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    THAPSDRAFT_2525
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    THAPSDRAFT_2525
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    THAPSDRAFT_2525
Enzymes [BR:tps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     THAPSDRAFT_2525
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 563 aa AA seqDB search
MNRERFFSLSHQYTARLHLLLERRSVVGANGLPFQLLQHTTSSSKLSFHVASCYSRHSSC
KSDGKHNLQQLFNEVASRFDFTEKTPRKLAETTSSSSSSSSSSSQGTTFRTSASNLTSEL
CRAYISLPDVSVARWNDSYCKLQFLDSILNPDFGVDTSALISASSNITSHAPNSSHSSIR
RMRELCTPRYEKIFHFILGSALEDLGVAFLVKLRQDIREVIRYCRFGHGNDMEDVMEQLN
YKLSDLQALDRDIQSILSSLFRPGALNLQQITYDKTPASIIEQIAFKEAVHPLKSLQDLR
TRLGKGRRCFAFFHPALPDTPLVFVHIALLREIPESMDALQQGTERILNGTDDESRATCA
TFYSITNAEPGLAGVDLGNHLIKSVVHQLRVELPNLDKFCTLSPIPNFYRWLEGKVVRHN
EGTFTDDNLFSHQELDKLRALSRSDIKPPLLTLLDTLKDPQRWSTDVQLQHQLKPLLLKL
AAYHLTKETHHGRPLCPVAKFHIRNGAEMYRLNYLADTSSKGMRNSCGIMMNYRYVLEDM
EDNHVRYEMTGEVAVCDSVRRWL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaacagggaacgattctttagtttatcacaccaatacacagctagattgcatctgctg
ttagagcgacgcagtgtggtgggtgcaaatggcttgcctttccaacttcttcagcacaca
acatcgtcgtcgaaattgtcatttcatgtggcaagttgctacagccgacactcatcgtgc
aaatccgatggcaaacacaacctgcaacagttgtttaatgaagttgcctctcgcttcgac
tttacagagaagacacctcgtaaattagctgaaacaacatcatcatcatcgtcgtcgtcg
tcgtcgtcgtcgcaaggcacaacttttaggacatcagcgtccaaccttacgtcggagtta
tgccgtgcatacattagtcttcctgacgtttcagtggcaagatggaatgattcatattgt
aaactgcagttcttggactcgatactgaaccctgatttcggcgttgatacatcagccttg
atctctgcatcaagcaacatcacatcgcatgcacccaactcctcccacagttcaatacga
cggatgagagaactttgcacaccgcgatacgaaaagatatttcatttcattctggggtct
gcactggaagatttgggggtagctttcttagtaaagcttcggcaggatattcgtgaggtc
atacggtattgcaggtttggacatgggaacgacatggaagacgttatggaacaactgaac
tacaaactatccgacttgcaggcactggatcgcgacattcaatccattctctcgtcgtta
ttcagacctggtgcactcaatctacaacaaatcacatacgacaaaactcctgcttctatc
attgaacagattgctttcaaagaagcagtgcatcctctgaagagtttgcaagatttgaga
acgagattaggcaaaggcagacgatgctttgcattctttcacccggcattaccagacaca
ccccttgtgtttgttcatatagcgttgctacgtgaaattcctgagagtatggatgcttta
caacagggtactgaacggatattgaatggcacagacgatgaatcccgtgcaacctgtgca
accttctactcaattacaaacgctgaaccaggacttgccggagtggatctgggaaatcat
ctcatcaagtcagttgtgcatcagcttagagtggagctcccgaatctcgacaaattttgt
actctttcgccaatcccaaacttctaccggtggttggaaggaaaggttgtacggcacaac
gaaggtaccttcaccgacgacaatctattttctcatcaggagttggacaagttgcgtgca
ctctcccgctctgatatcaaaccgccattgctcacattattggacactctgaaagaccca
cagcgatggtcgactgacgtgcagttgcaacatcaactgaaacccttgcttctcaaactt
gcggcttatcaccttacaaaagaaactcatcatggacgcccactatgccctgtagcaaaa
tttcacattaggaacggagctgaaatgtaccggctcaactacttggcggatacgtcgtcc
aaggggatgaggaacagctgtggtattatgatgaactatcgatacgttctggaagatatg
gaagacaatcatgtgaggtatgaaatgactggagaagtagcggtgtgcgacagtgtaaga
cgatggctgtag

DBGET integrated database retrieval system