KEGG   Thalassiosira pseudonana: THAPSDRAFT_2538Help
Entry
THAPSDRAFT_2538   CDS       T01078                                 

Definition
serine threonine phosphatase (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tps  Thalassiosira pseudonana
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:tps00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    THAPSDRAFT_2538
Enzymes [BR:tps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     THAPSDRAFT_2538
Protein phosphatases and associated proteins [BR:tps01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     THAPSDRAFT_2538
Transcription machinery [BR:tps03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     THAPSDRAFT_2538
Spliceosome [BR:tps03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    THAPSDRAFT_2538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 317 aa AA seqDB search
MEPIQNIAQRLLSLRGSPPGTLASLAENEIKLLCQRVRPILLAQPMLLELEAPLKICGDI
HGQFTDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLEAVCLLICYKIMYPENFFILRGNH
ESAGINRIYGFYDECKRRYSIRLWKVFSDVFNCLPVSAIVDEKILCMHGGLSPEMERLQQ
IADLQRPCDVPDVGLMCDLLWSDPDTGVNGWAENDRGVSFVFGADVVAAFLEQHDLDLLV
RAHQVVEDGYEFFAGRRLVTLFSAPNYCGEFDNAGGMISVDENLMCSFQILKPSSRAARF
AQRNQQGGPGQNGIQGS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaacccatccaaaacattgcacaacgtctgctctctctccgcggctcacctcccggg
acactcgccagtctcgccgagaatgagatcaaactcttgtgtcaacgcgtacgtcccatc
ctcttggcccaaccaatgttattggaactagaagcgccgttgaagatatgcggtgacatt
catggacaattcacagatctcctaaggttattcgaatacggaggcttccccccagaaagc
aactatctctttctgggtgattatgtcgaccgcggcaagcaatccctcgaagcggtctgt
ctcctcatttgctacaaaataatgtaccccgaaaacttcttcatccttcgtggtaaccac
gaatcagctggcatcaaccgcatctacggattctatgacgagtgcaaacgtcgctattcc
attagattatggaaggtgttcagtgatgtgttcaactgtttaccggttagtgcgattgta
gatgaaaagattttgtgcatgcatggggggttgagtccggagatggaacggttgcagcag
attgcggatttgcagaggccgtgtgatgtaccggatgtggggttgatgtgtgatttgttg
tggagtgatcctgatacgggggtgaatggatgggctgaaaacgacagaggggtgtcattc
gtattcggtgccgatgtagtagcagcctttctagaacaacacgaccttgaccttctcgtc
cgagcccatcaagtagtcgaagacggctacgagttctttgcgggtcgtcgtctcgtcaca
ctcttttcagcaccgaattactgtggagaatttgacaatgccggtggtatgatttcggtg
gatgagaacttgatgtgttcctttcagatattgaagcctagttcgagggcggcgaggttt
gcgcagaggaatcaacagggtggaccggggcagaatggaattcaggggagttag

DBGET integrated database retrieval system