KEGG   Thalassiosira pseudonana: THAPSDRAFT_25605Help
Entry
THAPSDRAFT_25605  CDS       T01078                                 

Gene name
trpAB
Definition
(RefSeq) tryptophane synthase (EC:4.2.1.20)
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THAPSDRAFT_25605 (trpAB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THAPSDRAFT_25605 (trpAB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THAPSDRAFT_25605 (trpAB)
Enzymes [BR:tps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     THAPSDRAFT_25605 (trpAB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 684 aa AA seqDB search
MTTSSSMARGHNGRIEQAFAEAKDRGEAAFVTFVTAGFPVKEDTPAILLAMQAGGASVIE
LGIPYTDPQADGTTIQQTNQVAIKAGTSDITQCLSMLESARSQGLTVPVVLMGYYNPFFQ
YGIESMCKKAKECGADGFIVVDLPPEEGADLAKACNKYGLSNIPLIAPTTTDERIGHLAK
TASTFIYCVSTTGVTGARSELPSDLDDFIKRVRSKTDLPLAVGFGISNATMVQSVANIGD
GVVVGSAILRAVQSAGDSTEERVEAVKKIVSELSAGCKQGGDDEVADQIAALNINKRFGK
FGGQFIPETLSEAFREIEAEYEKVKNDPAFLAELDVYRRDFVGGPTPLHKAERLTEMCGG
ATIWLKREDLAHTGAHKINNAVGQALLAKRIGKPRIIAETGAGQHGVATATICAKLGLDC
TVYMGAVDCERQKLNVFRMNTLGAKVVPVKEGQATLKDAINEAMRDWVTNVRDTHYLIGS
AVGPHPFPTIVRDFQSVMGKEMKAQMLDKAGKLPDVVIACVGGGSNAIGAFHPFVEDKTV
ELHGVEAAGHGIDKDEQHCATLTKGTPGVLQGAFTYVIQEKSGQTLNTHSVSAGLDYPGV
GPEHAFLKDSGRAKYTAVTDDEALEGFKMMCQYEGIIPALETSHAIYYAIQLAKTLGKDK
DIVINMSGRGDKDMPQSWSLSGEN
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatcatcatccatggcccgaggccacaacggacgtatcgaacaggcgttcgcc
gaggcgaaggatcgtggagaggctgcgtttgttacctttgttacggctgggtttcctgtc
aaggaagacacacctgccattctcctagcaatgcaagcgggcggagcctccgtcatcgaa
ctcggaatcccctacaccgacccccaagccgacggcaccaccatccagcaaaccaaccaa
gtcgccatcaaagccggaacatccgacatcacccaatgcctctccatgctcgagtcggca
cgctctcagggattgaccgtccccgtagtgctcatggggtattacaatcccttcttccag
tatgggattgaaagcatgtgcaaaaaagccaaggagtgtggtgccgatgggtttattgtg
gtggatttgcctcccgaggaaggagccgatttggccaaggcttgtaataagtacggattg
tcgaatattcccttgattgcacccaccacgaccgatgaacgtatcggtcatttggccaag
acggcgagtacctttatttactgtgtgagtaccaccggtgttaccggcgcgaggagcgag
ttgcccagtgatttggacgatttcatcaagagggttagaagtaagaccgacttgccattg
gctgttggtttcggtatctcgaacgctaccatggttcaaagcgtggcgaatattggagac
ggagttgtcgtcgggagtgcaattctgcgtgccgttcagagtgcgggggacagtaccgag
gagagggtggaggccgtgaagaagattgtttcggagttgagtgcgggttgtaagcaggga
ggggatgatgaggtggcggatcagattgccgctttgaatatcaacaaacgattcggtaaa
tttggaggacagttcattccggaaacgttgtcggaggctttccgagagattgaggcagag
tacgagaaggttaagaatgatcctgcctttttggcagagttggatgtgtaccgtcgtgac
tttgtgggaggacccactccattgcacaaggcggagaggttgacggagatgtgtggaggt
gccaccatttggctcaagagggaggatttggctcatacaggtgctcacaagattaacaat
gccgtgggacaggcgcttctagccaagaggattggaaagcctcgtatcattgccgagacg
ggagccggacagcacggtgttgccacggcgacgatttgtgccaagcttggattggactgt
accgtttacatgggagctgtggactgcgagcgtcagaagttgaatgtgttccgtatgaac
actttgggggcaaaggttgtgcccgtgaaggagggacaggctaccttgaaggatgccatt
aacgaggctatgcgtgactgggtgaccaacgtacgtgatactcactatcttattggatct
gccgtcggaccgcacccgttccctaccattgtgcgagacttccaatcagtcatgggtaaa
gagatgaaggctcagatgctcgataaggcaggaaagcttcccgatgttgtcattgcttgt
gttggaggaggatccaacgccattggtgccttccaccctttcgttgaggataagactgtg
gagttgcacggagtcgaggctgctggccacggaattgataaggatgagcagcactgtgct
accttgaccaagggaactcccggtgtcttgcagggtgcattcacctacgtcattcaagag
aagagtgggcagactttgaacacccacagtgtctccgctggtttggactatcccggagtc
ggcccagagcacgcatttttgaaggacagcggaagggccaagtacacagccgtcactgac
gacgaggcacttgagggattcaaaatgatgtgtcagtacgaaggcatcattcctgctctt
gagacaagtcatgctatctactatgctatccaactggccaagactttgggcaaggataag
gatatcgtgattaacatgagtggacgtggagataaggatatgccacagtcatggagttta
tcgggagagaactga

DBGET integrated database retrieval system