KEGG   Thalassiosira pseudonana: THAPSDRAFT_25605Help
Entry
THAPSDRAFT_25605  CDS       T01078                                 

Gene name
trpAB
Definition
tryptophane synthase (EC:4.2.1.20)
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THAPSDRAFT_25605 (trpAB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THAPSDRAFT_25605 (trpAB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    THAPSDRAFT_25605 (trpAB)
Enzymes [BR:tps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     THAPSDRAFT_25605 (trpAB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 684 aa AA seqDB search
MTTSSSMARGHNGRIEQAFAEAKDRGEAAFVTFVTAGFPVKEDTPAILLAMQAGGASVIE
LGIPYTDPQADGTTIQQTNQVAIKAGTSDITQCLSMLESARSQGLTVPVVLMGYYNPFFQ
YGIESMCKKAKECGADGFIVVDLPPEEGADLAKACNKYGLSNIPLIAPTTTDERIGHLAK
TASTFIYCVSTTGVTGARSELPSDLDDFIKRVRSKTDLPLAVGFGISNATMVQSVANIGD
GVVVGSAILRAVQSAGDSTEERVEAVKKIVSELSAGCKQGGDDEVADQIAALNINKRFGK
FGGQFIPETLSEAFREIEAEYEKVKNDPAFLAELDVYRRDFVGGPTPLHKAERLTEMCGG
ATIWLKREDLAHTGAHKINNAVGQALLAKRIGKPRIIAETGAGQHGVATATICAKLGLDC
TVYMGAVDCERQKLNVFRMNTLGAKVVPVKEGQATLKDAINEAMRDWVTNVRDTHYLIGS
AVGPHPFPTIVRDFQSVMGKEMKAQMLDKAGKLPDVVIACVGGGSNAIGAFHPFVEDKTV
ELHGVEAAGHGIDKDEQHCATLTKGTPGVLQGAFTYVIQEKSGQTLNTHSVSAGLDYPGV
GPEHAFLKDSGRAKYTAVTDDEALEGFKMMCQYEGIIPALETSHAIYYAIQLAKTLGKDK
DIVINMSGRGDKDMPQSWSLSGEN
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatcatcatccatggcccgaggccacaacggacgtatcgaacaggcgttcgcc
gaggcgaaggatcgtggagaggctgcgtttgttacctttgttacggctgggtttcctgtc
aaggaagacacacctgccattctcctagcaatgcaagcgggcggagcctccgtcatcgaa
ctcggaatcccctacaccgacccccaagccgacggcaccaccatccagcaaaccaaccaa
gtcgccatcaaagccggaacatccgacatcacccaatgcctctccatgctcgagtcggca
cgctctcagggattgaccgtccccgtagtgctcatggggtattacaatcccttcttccag
tatgggattgaaagcatgtgcaaaaaagccaaggagtgtggtgccgatgggtttattgtg
gtggatttgcctcccgaggaaggagccgatttggccaaggcttgtaataagtacggattg
tcgaatattcccttgattgcacccaccacgaccgatgaacgtatcggtcatttggccaag
acggcgagtacctttatttactgtgtgagtaccaccggtgttaccggcgcgaggagcgag
ttgcccagtgatttggacgatttcatcaagagggttagaagtaagaccgacttgccattg
gctgttggtttcggtatctcgaacgctaccatggttcaaagcgtggcgaatattggagac
ggagttgtcgtcgggagtgcaattctgcgtgccgttcagagtgcgggggacagtaccgag
gagagggtggaggccgtgaagaagattgtttcggagttgagtgcgggttgtaagcaggga
ggggatgatgaggtggcggatcagattgccgctttgaatatcaacaaacgattcggtaaa
tttggaggacagttcattccggaaacgttgtcggaggctttccgagagattgaggcagag
tacgagaaggttaagaatgatcctgcctttttggcagagttggatgtgtaccgtcgtgac
tttgtgggaggacccactccattgcacaaggcggagaggttgacggagatgtgtggaggt
gccaccatttggctcaagagggaggatttggctcatacaggtgctcacaagattaacaat
gccgtgggacaggcgcttctagccaagaggattggaaagcctcgtatcattgccgagacg
ggagccggacagcacggtgttgccacggcgacgatttgtgccaagcttggattggactgt
accgtttacatgggagctgtggactgcgagcgtcagaagttgaatgtgttccgtatgaac
actttgggggcaaaggttgtgcccgtgaaggagggacaggctaccttgaaggatgccatt
aacgaggctatgcgtgactgggtgaccaacgtacgtgatactcactatcttattggatct
gccgtcggaccgcacccgttccctaccattgtgcgagacttccaatcagtcatgggtaaa
gagatgaaggctcagatgctcgataaggcaggaaagcttcccgatgttgtcattgcttgt
gttggaggaggatccaacgccattggtgccttccaccctttcgttgaggataagactgtg
gagttgcacggagtcgaggctgctggccacggaattgataaggatgagcagcactgtgct
accttgaccaagggaactcccggtgtcttgcagggtgcattcacctacgtcattcaagag
aagagtgggcagactttgaacacccacagtgtctccgctggtttggactatcccggagtc
ggcccagagcacgcatttttgaaggacagcggaagggccaagtacacagccgtcactgac
gacgaggcacttgagggattcaaaatgatgtgtcagtacgaaggcatcattcctgctctt
gagacaagtcatgctatctactatgctatccaactggccaagactttgggcaaggataag
gatatcgtgattaacatgagtggacgtggagataaggatatgccacagtcatggagttta
tcgggagagaactga

DBGET integrated database retrieval system