KEGG   Thalassiosira pseudonana: THAPSDRAFT_260919Help
Entry
THAPSDRAFT_260919 CDS       T01078                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tps  Thalassiosira pseudonana
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THAPSDRAFT_260919
   01230 Biosynthesis of amino acids
    THAPSDRAFT_260919
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THAPSDRAFT_260919
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THAPSDRAFT_260919
Enzymes [BR:tps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     THAPSDRAFT_260919
Exosome [BR:tps04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   THAPSDRAFT_260919
  Exosomal proteins of melanoma cells
   THAPSDRAFT_260919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 213 aa AA seqDB search
LILTRHGDSIWNGKETFTGWTDVPLSPIGEQEAIRTGQLLTQHTSGVVIDALFTSTLSRA
KMTAHHYQVPRQYLIDHRLNERHYGALQGLVKSDAELGLFGHSPSEVLEWRRSWHAVPPL
LDEEDPRRLEELRLYGNLCDGVQNVPRGESLAMVASERIRPFLKDRLTPLLDKGGTALIV
AHANSLRALIGHDSAALRKLEAMKIPTASPLVL
NT seq 640 nt NT seq  +upstreamnt  +downstreamnt
ctcatcttgactcggcacggagactccatatggaatggcaaagagaccttcaccggatgg
actgacgttcctctgtcgccaattggtgaacaggaggcaatacgtactggtcaattgctc
acacaacacacaagtggcgttgttatcgatgcactgttcacgtcgacgttgagtagggca
aagatgactgctcatcattatcaggtgcctcggcaatacctgatagatcatcgtcttaat
gagcggcactacggtgctttacaaggtctcgtgaaatcagatgcagagctggggctcttt
ggacattctccgagtgaggtcctagaatggagacgaagttggcatgctgtgcctccactg
cttgatgaagaagatccaagacggttggaagaattgagattgtacggcaatctttgtgac
ggcgtacaaaacgtaccgagaggagaaagcttagccatggttgcttctgaacggatacga
ccattcttgaaagatagattgactcctctgttggataagggggggacggcattgatagtt
gcacatgccaactctctacgtgctttgattggacatgattcagcagcattgcgtaaactg
gaagcaatgaagataccgacggcaagtcctttggtgctga

DBGET integrated database retrieval system